SecReT4
Protein ID: 209544950
T4SS name [ID]Trb [260]
Gene symbol-
Locus tagGdia_2832
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]3096386..3097459 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB5ZHT6
KEGG IDgdj:Gdia_2832
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.4e-70, Aligned region: 127..350
Protein Sequence: 357 a.a.     [Download]
>gi|209544950|ref|YP_002277179.1| P-type conjugative transfer protein TrbG [Gluconacetobacter diazotrophicus PAl 5]
MTPPISMEAGGPASRLSVSQQDRQGGITPFRKAGLAALLLSVSALGGCAHKFIPPDINYDSATLANLTVD
PPAPVKIVELPKPLPLPGQLKPLNTGKPVPEAPDPTVRVNQANAAARIQPVRNGFINAVQVYPYSAGALY
QAYTAPGEITDIALQEGEQLVGTGPVAAGDTVRWIIGDTESGAGATKKIHILVKPTRPDLVTNLVINTDR
RTYLLELRSTEKTYMASVSWQYPEDQLIALRQQNAAAETVAPIATGVDLAAINFRYAIEGDNPAWRPLRA
FDDGQKVYIEFPSGIRQGEMPPLFVIGPAGGSELVNYRVRQNYYIVDRLFAAAELRLGDKDSERRVRIVR
TDGRPRS
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|209542188|ref|NC_011365.1|:3096386-3097459 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGACCCCGCCGATTTCCATGGAAGCCGGCGGTCCGGCTTCACGTCTTTCAGTCTCTCAGCAGGACCGGC
AAGGAGGGATTACGCCTTTCCGTAAAGCCGGCCTTGCGGCTTTGCTGCTCTCCGTGTCAGCGCTCGGCGG
CTGCGCACACAAGTTCATCCCGCCGGACATCAACTATGACAGCGCGACGCTGGCGAATCTCACCGTCGAT
CCGCCCGCGCCGGTCAAGATCGTCGAGCTGCCCAAGCCCTTACCCTTGCCGGGTCAATTGAAGCCGCTCA
ACACGGGCAAGCCCGTCCCGGAGGCGCCCGATCCCACCGTGCGCGTCAACCAGGCGAATGCGGCCGCCCG
CATCCAGCCAGTTCGCAATGGCTTCATCAACGCCGTGCAGGTCTATCCCTATTCGGCGGGTGCGCTCTAT
CAGGCCTACACCGCACCGGGCGAGATCACCGACATCGCGCTGCAGGAGGGCGAGCAACTCGTCGGCACCG
GCCCGGTCGCCGCCGGCGACACGGTACGTTGGATCATCGGCGACACGGAGAGCGGCGCGGGCGCGACCAA
GAAGATCCACATCCTCGTCAAGCCGACGCGGCCTGACTTGGTGACGAACCTCGTCATCAACACCGATCGA
CGGACCTATCTACTTGAGCTGCGCTCGACCGAGAAAACCTACATGGCCTCGGTCTCCTGGCAGTACCCGG
AAGACCAGCTCATCGCGCTGCGCCAGCAGAATGCCGCGGCCGAGACGGTCGCGCCGATAGCCACCGGCGT
CGACCTTGCCGCGATCAACTTCCGCTATGCGATCGAGGGCGATAACCCCGCCTGGCGACCGCTGCGCGCC
TTCGACGATGGTCAGAAGGTCTACATCGAGTTCCCGTCCGGCATCCGCCAGGGCGAAATGCCGCCGCTCT
TCGTCATCGGGCCCGCCGGCGGCTCCGAGCTGGTGAATTACCGGGTCCGGCAGAACTACTACATCGTCGA
TCGCCTGTTTGCCGCGGCCGAGTTGCGCCTCGGAGACAAGGACAGCGAGCGGCGGGTCCGCATCGTCCGC
ACCGACGGAAGGCCGCGGTCATGA
 Primer design