SecReT4
Protein ID: 209552063
T4SS name [ID]VirB [785]
Gene symbol-
Locus tagRleg2_6211
StrainRhizobium leguminosarum bv. trifolii WSM2304
Repliconplasmid pRLG203 [GenBank: NC_011370] [Browse all T4SS(s) in this replicon]
Location [Strand]153610..154344 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDB6A5A4
KEGG IDrlt:Rleg2_6211
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.6e-38, Aligned region: 46..232
Protein Sequence: 244 a.a.     [Download]
>gi|209552063|ref|YP_002283979.1| VirB8 family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
MALFRKQLKPAPTDQIAGPQHIYDQHLSWGEKNRSLRTLIGLILLAFAVAGWVVAGVLSFSVAQLFPLVR
TEVVPLIVDKNTGYMETVTTLDKDRSSVAEMQAVRASFVGNYVIRRETYDPRYLSDNFDMIALWSEPNSE
AFKDYEAWMNPSNPRGPVKTMGATGDIRPEILSVNPLNASTMAVRFETRERQRGGDVVNRWSATVRFRQI
NLPASNRVRLYNPLGYVVTEYVKVPETMPSGLAP
 
Nucleotide Sequence: 735 bp     [Download]
>gi|209551938|ref|NC_011370.1|:153610-154344 Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG203, complete sequence
TTGGCATTGTTCAGAAAGCAATTAAAGCCTGCGCCGACCGATCAGATTGCCGGCCCGCAGCACATCTACG
ATCAGCATCTCTCCTGGGGAGAAAAGAACCGCTCGCTCAGAACCTTGATTGGTCTCATCCTGTTGGCCTT
CGCCGTTGCCGGCTGGGTCGTCGCCGGCGTGCTTTCTTTTTCGGTGGCGCAGCTTTTCCCGCTTGTCCGC
ACCGAGGTCGTTCCTCTCATCGTCGACAAGAACACGGGATACATGGAAACCGTGACGACGCTCGACAAGG
ATCGGTCGAGCGTCGCGGAAATGCAGGCTGTTCGGGCCTCCTTCGTCGGCAATTATGTCATCCGGCGAGA
GACCTACGATCCCCGATATCTGTCGGATAATTTCGACATGATCGCGCTGTGGTCGGAGCCGAACTCTGAA
GCTTTCAAAGACTACGAGGCGTGGATGAACCCGTCCAACCCACGAGGGCCTGTGAAAACCATGGGCGCGA
CCGGTGACATCCGTCCGGAGATCCTCTCGGTCAATCCACTCAATGCCTCGACCATGGCCGTCCGCTTCGA
GACACGGGAGCGCCAACGTGGTGGTGACGTCGTCAATCGGTGGTCTGCAACGGTACGCTTTCGCCAGATC
AATCTGCCAGCCAGCAACCGGGTTCGGCTTTACAATCCGCTCGGCTATGTTGTTACCGAATATGTGAAGG
TCCCAGAGACAATGCCTTCGGGGCTCGCTCCATGA
 Primer design