SecReT4
Protein ID: 209552066
T4SS name [ID]VirB [785]
Gene symbol-
Locus tagRleg2_6214
StrainRhizobium leguminosarum bv. trifolii WSM2304
Repliconplasmid pRLG203 [GenBank: NC_011370] [Browse all T4SS(s) in this replicon]
Location [Strand]156516..157565 [+]
ProductATPase P
Component typeVirB11
UniProt IDB6A5A7
KEGG IDrlt:Rleg2_6214
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-75, Aligned region: 18..319
FtsK_SpoIIIE [PF01580], Evalue: 2.8e-05, Aligned region: 158..193
Protein Sequence: 349 a.a.     [Download]
>gi|209552066|ref|YP_002283982.1| ATPase P [Rhizobium leguminosarum bv. trifolii WSM2304]
MNAHPAISAERHFLAEALEPIRAFLDDPAVVEISCQRSNEIWLEKIGQLSMVSQRVDGLDQDAIRHMASR
AASFTKQTVNAENPLLSAILTGGERVQFVLSPTSATGHAFSIRKQFIRRFDLDDYEKAGAFRFTKVTGDD
YTDDVDIELSTLLRAGKIRAFLELAAVNHRSMLISGGTSTGKTTFLNTMLTSIPNQERFILMQDTEELEP
RQENVVSLLVSKGGQGEARVTMTDLLATALRLRPDRIFMGELRGDEAFDFLNAINTGHPGSMSTIHANSP
HHAFNRLSTLVLNSNVRMERDDIIRYIRSIIPIVVQLKKSDAAGGRGVSEIYFADEVDKDGKRIHVSGD
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|209551938|ref|NC_011370.1|:156516-157565 Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG203, complete sequence
ATGAACGCACACCCCGCAATCTCCGCCGAACGGCATTTTCTGGCCGAGGCGCTGGAACCCATCCGGGCCT
TTCTCGACGATCCTGCCGTCGTCGAGATTTCCTGCCAGCGCAGCAACGAGATCTGGCTCGAGAAGATTGG
CCAGCTCAGCATGGTGAGCCAACGGGTCGACGGCCTGGACCAGGACGCGATCCGTCACATGGCGTCTCGC
GCGGCGTCTTTTACCAAGCAGACCGTCAACGCTGAGAACCCGCTGTTGTCGGCGATTTTGACGGGCGGCG
AGCGAGTACAGTTCGTCCTCAGCCCGACGTCGGCGACGGGGCATGCCTTCTCGATCCGCAAGCAGTTCAT
TCGTCGCTTCGACCTGGACGACTACGAGAAGGCAGGCGCGTTTCGCTTCACGAAGGTGACCGGCGATGAC
TATACCGATGACGTGGATATCGAGCTTTCAACGCTGCTCCGCGCCGGCAAGATTCGAGCGTTCCTGGAAC
TAGCGGCCGTCAATCACCGCAGTATGCTGATTTCCGGTGGGACATCCACCGGCAAGACGACGTTTCTCAA
CACCATGCTGACTTCCATTCCAAACCAGGAACGGTTCATCCTGATGCAGGATACGGAGGAACTCGAACCG
CGACAGGAAAATGTCGTGTCGCTGCTGGTCTCGAAGGGAGGCCAAGGGGAGGCCAGGGTCACCATGACTG
ATCTGCTGGCCACGGCGCTGCGGCTCAGGCCGGACAGGATCTTCATGGGCGAGCTGCGCGGCGACGAGGC
TTTTGATTTCCTGAACGCGATCAACACCGGCCATCCGGGATCGATGTCGACCATCCATGCGAACTCGCCG
CACCATGCGTTCAACCGCCTGTCGACGCTGGTGCTCAACAGCAATGTCCGCATGGAGCGCGACGATATCA
TTCGATATATCCGTTCGATCATCCCGATCGTGGTGCAGTTGAAGAAGAGCGATGCCGCCGGCGGCCGCGG
CGTCAGCGAGATCTACTTTGCCGATGAGGTGGACAAAGATGGCAAGCGTATTCACGTCAGCGGAGACTGA
 Primer design