SecReT4
Protein ID: 209552067
T4SS name [ID]VirB [785]
Gene symbol-
Locus tagRleg2_6215
StrainRhizobium leguminosarum bv. trifolii WSM2304
Repliconplasmid pRLG203 [GenBank: NC_011370] [Browse all T4SS(s) in this replicon]
Location [Strand]157534..160242 [+]
ProductTRAG family protein
Component typeVirD4
UniProt IDB6A5A8
KEGG IDrlt:Rleg2_6215
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.6e-66, Aligned region: 241..655
TrwB_AAD_bind [PF10412], Evalue: 2.9e-25, Aligned region: 260..647
TraG-D_C [PF12696], Evalue: 4.8e-20, Aligned region: 518..633
AAA_10 [PF12846], Evalue: 1e-09, Aligned region: 265..587
Protein Sequence: 902 a.a.     [Download]
>gi|209552067|ref|YP_002283983.1| TRAG family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
MASVFTSAETDRPKWTVLQRASLITLPVALFCAVMLWLIFFTLIYDAYISSFGSASYFDYVEQVRFVDAL
RYTWSIIHTRNTAGLSLLAFALAAPFLFLLLSLWMLKAGRALSRKILYLLHVRSVFSLIAHTALVFAAAY
AGVIVYGVAFYLVATKAGEHAEIAGYYGNHLAAMYQAPFGATDTAGIYQQPSRQTVLASLAGLAAAGALV
GFPIGAAIQRRQRMIMGRARLATLKDAADFRLRDKRGIVLGLKQGLLLRNDGDQHVMVIGSPGQGKSRGF
VIPTMMSFEGSQMVLDMSGELFEETSGYLKDKGYEVFLLAPGSKFTDGYNPLDLVSTEPNQRITDLQKLT
QMLLPERLRSDSSDFWEESARILLTAMLGFVLECPDTRKSLSELYRILNSMSDERKAIVQLLENYEAVLS
DQTRMQLTKFAGRHEKLGEGIAAEIVAKLNFLQNPLVEALTSITSIPIDTIRKRKMVVYIQADWNAMQIY
ERLISMFIQQMADKLVQLGPLRNGEHEVLMMLDEFGNGGRIDTVLTLAPLIRKNGVRFVFILQDGAQLER
LYQRSGQKILMGASTIKLFMNFQNQEDATAVSLAAGKTTEWVEQSSYSHRHGRRQRSISKVPVSVDLLPV
NTLIMMKPEEAILQVTGMPLMRIMKLDSGGERMFAKVRKFGPVSRPCMEPVEWTIGHRDHAAGTRPGQAN
DERFIVKDGVRHVYISSLDELRDRLDLDETREVGGGDDDPPAAEQKRRKEAVTETVGGHWEHRAPNRHRP
DRDPGVGLKIDERRLADNVYSGSPARNGRRRQAADHFTDHAASHPAEPGVLKRQEVREAFGSDLRTLNDA
IFEQADELALEPTDLNSDVDLLIGTLSNRLTETSSLDYLHRFARVARDPLGEDVEQLDEPGE
 
Nucleotide Sequence: 2709 bp     [Download]
>gi|209551938|ref|NC_011370.1|:157534-160242 Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG203, complete sequence
ATGGCAAGCGTATTCACGTCAGCGGAGACTGACCGCCCAAAATGGACCGTCCTGCAGCGTGCCTCGCTGA
TTACCTTGCCGGTCGCGCTGTTTTGCGCGGTCATGCTTTGGCTTATTTTTTTCACGCTGATCTACGACGC
CTATATCTCCTCCTTTGGATCGGCCTCCTACTTCGACTATGTCGAGCAGGTGCGCTTCGTCGACGCTCTC
CGCTATACCTGGTCGATCATTCACACTCGCAACACCGCCGGATTGTCGCTGCTGGCTTTCGCGCTTGCCG
CGCCATTCCTGTTTCTCCTGCTCAGCCTCTGGATGCTGAAGGCAGGCAGGGCGCTGTCGCGCAAGATCCT
CTACCTACTGCATGTCCGCTCGGTGTTCAGCCTGATCGCGCATACGGCTCTGGTCTTCGCGGCTGCCTAT
GCCGGCGTGATCGTCTATGGCGTGGCCTTTTATCTCGTGGCCACCAAAGCCGGCGAACACGCCGAGATCG
CCGGCTACTACGGCAACCATTTGGCAGCGATGTATCAGGCGCCTTTCGGCGCAACCGACACGGCGGGGAT
CTATCAGCAGCCTTCGCGGCAGACGGTGCTCGCCTCACTTGCCGGTCTTGCCGCCGCCGGTGCGTTGGTA
GGATTTCCGATCGGCGCAGCCATCCAGCGTCGCCAGCGGATGATCATGGGTCGGGCGCGCCTGGCGACCC
TGAAGGACGCGGCCGACTTTCGGCTGCGCGACAAGCGCGGAATCGTCCTCGGTCTGAAACAAGGGCTCTT
GCTGCGCAACGACGGCGACCAGCACGTCATGGTCATCGGCTCACCGGGGCAAGGCAAATCGCGTGGCTTC
GTGATCCCGACGATGATGAGTTTCGAAGGATCGCAGATGGTCCTCGATATGAGCGGAGAACTCTTCGAGG
AAACGTCGGGATACCTGAAGGACAAGGGCTACGAGGTTTTTCTTCTGGCGCCCGGCTCGAAATTTACCGA
CGGCTATAACCCGCTCGATCTTGTTAGCACCGAGCCGAACCAGCGGATCACCGACCTGCAGAAGCTGACG
CAGATGCTGCTGCCGGAACGCCTGCGGTCCGACTCTTCCGACTTCTGGGAGGAGAGCGCCCGGATCCTAC
TGACGGCGATGCTGGGGTTTGTGCTCGAATGCCCGGACACGCGTAAGTCCTTGAGCGAACTTTACCGCAT
CCTCAATTCCATGTCCGACGAGCGCAAGGCGATCGTGCAATTGCTGGAAAACTACGAGGCGGTCCTTTCC
GACCAGACCCGTATGCAACTGACCAAATTCGCTGGCCGCCACGAAAAGCTCGGGGAGGGGATCGCAGCGG
AGATCGTCGCCAAACTCAACTTCTTGCAGAACCCGCTGGTCGAAGCGCTTACGTCGATCACGTCAATCCC
GATCGACACCATCAGAAAGCGGAAGATGGTGGTGTATATCCAGGCGGACTGGAACGCTATGCAGATCTAC
GAGCGATTGATCTCGATGTTCATCCAACAGATGGCCGACAAGCTTGTTCAGTTGGGTCCGTTGCGCAACG
GCGAGCACGAGGTCCTGATGATGCTCGACGAGTTCGGCAATGGCGGCCGGATCGATACGGTGCTGACGCT
CGCGCCGCTGATCCGCAAGAACGGCGTGCGCTTCGTGTTCATTCTCCAGGACGGTGCCCAGCTCGAGCGC
CTGTACCAACGTTCCGGCCAGAAGATTCTGATGGGCGCTTCCACTATCAAGCTGTTCATGAACTTCCAGA
ACCAGGAGGACGCGACGGCGGTCTCCTTAGCCGCCGGCAAGACAACGGAATGGGTTGAACAATCTTCCTA
TTCCCACAGGCATGGCCGCAGGCAACGATCGATTTCGAAAGTCCCGGTCTCGGTCGACCTGCTTCCCGTC
AACACGCTGATAATGATGAAACCCGAGGAGGCAATCCTGCAGGTCACCGGCATGCCGCTGATGCGGATCA
TGAAACTCGATTCTGGCGGCGAGCGGATGTTCGCTAAAGTGCGCAAATTCGGGCCAGTGTCGCGGCCATG
CATGGAGCCGGTCGAATGGACGATCGGCCATCGCGACCACGCAGCCGGCACGAGGCCGGGGCAAGCCAAC
GACGAACGCTTCATCGTCAAAGACGGTGTTCGCCATGTCTATATCTCCTCGCTTGATGAGCTTCGCGATC
GGCTCGACCTGGATGAAACGCGCGAGGTTGGGGGCGGCGACGATGATCCTCCCGCCGCGGAGCAGAAGCG
ACGGAAGGAGGCGGTCACGGAAACTGTCGGAGGGCATTGGGAGCACCGCGCGCCGAACCGGCATCGTCCC
GACCGTGACCCCGGCGTTGGTCTGAAAATCGACGAGCGGAGACTTGCGGATAATGTCTATTCGGGATCTC
CGGCTCGCAACGGCCGTCGACGCCAAGCTGCCGACCATTTTACGGATCATGCCGCCTCGCACCCTGCGGA
GCCAGGCGTCCTCAAGCGACAGGAGGTCAGGGAGGCGTTCGGAAGCGACTTGAGGACCTTGAACGATGCG
ATCTTCGAGCAGGCCGACGAGCTCGCACTCGAACCAACCGACCTCAATTCGGATGTCGACCTCCTGATCG
GGACCTTATCGAACCGCCTGACAGAGACGAGTTCACTGGATTACCTGCATCGGTTCGCGAGGGTGGCGCG
CGATCCGTTGGGCGAGGACGTCGAGCAACTCGATGAGCCGGGCGAATAG
 Primer design