SecReT4
Protein ID: 209883341
T4SS name [ID]Trb [358]
Gene symbol-
Locus tagOCAR_4184
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]190540..191523 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDB6JA67
KEGG IDoca:OCAR_4184, ocg:OCA5_c03290
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-62, Aligned region: 104..320
Protein Sequence: 327 a.a.     [Download]
>gi|209883341|ref|YP_002287198.1| conjugal transfer protein TrbG/VirB9/CagX [Oligotropha carboxidovorans OM5]
MNPSFRRSAFPVFRKSAFAAALLSATVLAGCATAPKPPQISYDSTVPPLPSVPAVITDQRPRPLHTPPAW
IPARGGNSASTPTARVENANAAARVEPRRDGYYNSIQIYPWSEGALYQVYAAPGQITNIALEPGENLTGA
GPIAAGDTARWIIGDTESGSGVTRRVHVLVKPTRTDITTNLVITTDRRVYMIELRAGTNPYMPAVAWAYP
EPPASQRANVPARPVVPAATARNYRYGLMGDTPPWRPVSVYDDGRRVYVEFPRGIVQGEMPPIFVIGSDG
EPQIVNSRIYQNILIVDRIFGAAELRLGGGDRQQTVRIVRTDGRPAS
 
Nucleotide Sequence: 984 bp     [Download]
>gi|209883160|ref|NC_011386.1|:c191523-190540 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGAACCCGTCTTTCCGCAGGTCCGCGTTTCCTGTTTTCCGTAAATCCGCCTTTGCGGCTGCCCTGCTGT
CCGCAACCGTCCTCGCCGGTTGCGCCACCGCGCCGAAACCGCCGCAGATCAGCTACGATAGCACTGTTCC
ACCACTTCCGTCGGTCCCGGCAGTCATCACGGATCAGCGGCCACGTCCGCTGCATACGCCTCCGGCCTGG
ATCCCGGCCCGGGGCGGCAATTCCGCGAGCACGCCGACCGCGCGCGTCGAGAACGCCAACGCCGCCGCGC
GTGTCGAGCCGCGGCGAGACGGCTATTACAACTCCATCCAGATCTATCCCTGGAGTGAAGGGGCCCTCTA
TCAGGTCTATGCCGCGCCCGGGCAGATCACGAATATCGCGCTTGAGCCGGGCGAAAACCTGACCGGAGCA
GGTCCGATCGCCGCCGGTGACACGGCCAGGTGGATTATCGGCGACACCGAAAGCGGCTCGGGCGTGACCC
GCCGCGTCCATGTGCTCGTGAAGCCGACCAGGACCGACATCACGACCAATCTCGTCATCACGACCGATCG
GCGCGTCTACATGATCGAACTGCGCGCGGGCACGAACCCCTATATGCCCGCCGTGGCATGGGCCTATCCC
GAGCCCCCAGCCAGCCAACGCGCCAACGTCCCGGCGAGGCCCGTCGTTCCTGCCGCGACTGCGCGCAACT
ATCGCTATGGCCTGATGGGCGATACGCCCCCATGGCGTCCGGTCTCGGTCTATGACGATGGGCGGCGCGT
CTACGTCGAATTCCCGCGCGGCATCGTCCAGGGCGAGATGCCGCCGATCTTCGTCATCGGCTCCGACGGC
GAGCCGCAAATCGTCAACAGCCGCATCTACCAGAACATCCTGATCGTCGATCGCATCTTTGGTGCAGCCG
AACTGCGTCTCGGAGGCGGCGATCGTCAGCAGACCGTCAGGATCGTCCGTACTGACGGGAGGCCCGCATC
ATGA
 Primer design