SecReT4
Protein ID: 209883348
T4SS name [ID]Trb [358]
Gene symbol-
Locus tagOCAR_4191
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]197387..197719 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB6JA74
KEGG IDoca:OCAR_4191, ocg:OCA5_c03230
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.1e-24, Aligned region: 10..100
Protein Sequence: 110 a.a.     [Download]
>gi|209883348|ref|YP_002287205.1| conjugal transfer protein TrbC [Oligotropha carboxidovorans OM5]
MIRTFARGCHTMATAAAAVSISVLFTQAAHASGSSMPWEAPLQSILQSIEGPVAKIIAVIIIIVTGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGAVI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|209883160|ref|NC_011386.1|:c197719-197387 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGATCCGCACCTTCGCGCGCGGCTGCCACACCATGGCGACCGCCGCTGCCGCTGTTTCCATCAGCGTGC
TTTTCACCCAGGCCGCTCACGCCTCCGGCTCCTCGATGCCGTGGGAAGCGCCGCTGCAATCCATCCTCCA
ATCGATCGAGGGGCCGGTGGCGAAGATCATCGCCGTGATCATCATCATCGTCACCGGTCTGACGCTGGCA
TTCGGCGACACCTCAGGCGGATTCCGCCGCCTGATCCAGATCGTCTTCGGCCTGTCGATCGCGTTCGCGG
CGTCGAGCTTCTTCCTGTCCTTCTTCTCGTTCGGCGGCGGGGCGGTGATCTGA
 Primer design