SecReT4
Protein ID: 209885546
T4SS name [ID]Trb [359]
Gene symboltrbL2
Locus tagOCAR_6425
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]2365266..2366672 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB6JHP1
KEGG IDoca:OCAR_6425, ocg:OCA5_c16230
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.5e-51, Aligned region: 36..260
Protein Sequence: 468 a.a.     [Download]
>gi|209885546|ref|YP_002289403.1| conjugal transfer protein TrbL [Oligotropha carboxidovorans OM5]
MNTGVIDRFLETFTRYIDSGFGLLGGEIGFLTSTLIVIDITLAGLFWAWGADEDVLARLVKKTLYIGFFA
FIIGNFNKLAGIVFQSFSGLGLKAGGSSMTADTLLQPGRVAQVGIDAGTPILKAAGDLMGYISFFENFVQ
IMVLMIAWAIVLIAFFILAVQIFVTLIEFKLTTLAGFVLIPFALFNKTAFLAEKVLGNIVASGIKILVLA
VIVGIGSGLFSEFTTGFSGTPTITDALALVLGALSLMGLSIFGPGIATGLVSGAPQLGAGAAVGTGLAAA
GIGAAGVMGATAGISGAASAIGTGGRLSAASARGGAYLAGGVAQSYGQSASASGASGMRKAAAGVGGVAK
AGAGAAVQPVRQAVSRATQSLRSGADSLRSSYAAGRAAASNAAGGQASAGSAVAAGNTSTGGATGAGAAA
SSAPPNWAARMKRSQTMSHGATAAAHAVRSGDHGGGSMSVSLDQDDRK
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|209883160|ref|NC_011386.1|:c2366672-2365266 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGAACACCGGCGTCATCGACCGCTTTCTGGAGACCTTCACCCGCTACATCGATTCAGGCTTCGGTCTGC
TCGGCGGCGAGATCGGATTCCTCACCTCCACGCTGATCGTCATCGACATCACGCTGGCCGGCCTATTCTG
GGCGTGGGGCGCTGATGAAGACGTACTTGCGCGTCTCGTCAAGAAGACACTTTATATCGGCTTCTTCGCC
TTCATCATCGGCAACTTCAACAAGCTCGCCGGCATCGTCTTCCAGTCCTTCAGCGGCCTCGGCCTGAAGG
CCGGCGGATCGTCGATGACGGCCGACACGCTGCTTCAACCCGGCCGTGTCGCGCAGGTCGGCATCGACGC
CGGCACTCCCATCCTCAAGGCCGCTGGCGACCTGATGGGCTACATCTCCTTCTTCGAGAACTTCGTGCAG
ATCATGGTGCTGATGATCGCCTGGGCGATCGTGCTCATCGCCTTTTTCATCCTCGCCGTCCAGATCTTCG
TCACGTTGATCGAGTTCAAGCTCACGACCTTAGCCGGGTTCGTCCTGATCCCCTTCGCGCTGTTCAACAA
GACCGCGTTCCTCGCCGAAAAGGTGCTTGGCAACATCGTTGCCTCCGGCATCAAGATATTGGTGCTCGCC
GTCATCGTCGGCATCGGCTCCGGCCTGTTCAGTGAGTTCACGACCGGATTCTCCGGCACGCCGACCATCA
CCGACGCGCTGGCACTCGTGCTCGGTGCGCTGTCGCTGATGGGCCTGTCGATCTTCGGTCCCGGTATCGC
CACCGGGCTCGTCTCCGGCGCACCGCAACTCGGTGCGGGAGCCGCCGTTGGCACCGGCCTTGCCGCCGCC
GGCATCGGCGCGGCTGGCGTGATGGGAGCGACAGCGGGCATTTCCGGCGCGGCGAGCGCGATCGGAACCG
GCGGCCGCTTGTCGGCGGCAAGCGCACGCGGCGGCGCATACCTCGCGGGCGGCGTCGCCCAATCCTACGG
GCAGTCGGCTTCGGCCTCTGGCGCATCCGGTATGAGGAAGGCGGCTGCCGGCGTCGGTGGCGTGGCCAAG
GCTGGCGCTGGAGCGGCTGTTCAACCGGTCCGGCAGGCGGTGTCGCGCGCCACCCAATCCCTTCGGTCGG
GGGCGGATTCCCTTCGGTCGAGTTATGCGGCGGGCCGGGCCGCCGCATCGAACGCTGCCGGTGGACAGGC
ATCTGCGGGGTCGGCGGTCGCTGCGGGCAATACCTCAACGGGCGGGGCGACAGGTGCGGGAGCAGCGGCT
TCGTCGGCGCCGCCCAACTGGGCCGCGCGCATGAAACGCAGCCAGACCATGAGCCACGGCGCGACCGCCG
CCGCCCATGCCGTGCGCTCTGGCGATCACGGCGGCGGCTCCATGTCCGTTTCTCTCGACCAGGATGACCG
CAAATGA
 Primer design