SecReT4
Protein ID: 209885550
T4SS name [ID]Trb [359]
Gene symbol-
Locus tagOCAR_6429
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]2370472..2370807 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB6JHP5
KEGG IDoca:OCAR_6429
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.3e-26, Aligned region: 6..101
Protein Sequence: 111 a.a.     [Download]
>gi|209885550|ref|YP_002289407.1| conjugal transfer protein TrbC [Oligotropha carboxidovorans OM5]
MTLLALSRVRRRLTDATVLAATTLLMAAPAHASGSSMPWEEPLQKILESIEGPVAKIVAVIIIITTGLTL
AFGDTGGGFRKLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 336 bp     [Download]
>gi|209883160|ref|NC_011386.1|:c2370807-2370472 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGACCTTGCTTGCCTTGTCTCGTGTGCGCCGTCGCTTGACCGATGCGACCGTGCTCGCCGCGACCACGC
TGTTGATGGCGGCGCCGGCCCATGCCTCCGGTTCGTCGATGCCATGGGAAGAACCGCTGCAAAAAATCCT
CGAATCCATCGAGGGGCCGGTGGCTAAGATCGTGGCGGTCATCATCATCATCACCACCGGCCTCACGCTC
GCCTTCGGCGATACGGGTGGCGGGTTCCGCAAGCTGATTCAGATCGTATTCGGCCTGTCGATCGCCTTCG
CGGCCAGCTCTTTCTTCTTGAGTTTCTTCAGCTTCGGCGGCGGAGCGCTGGTGTGA
 Primer design