SecReT4
Protein ID: 209886708
T4SS name [ID]Trb [360]
Gene symbol-
Locus tagOCAR_7600
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]3555668..3556624 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDB6JJV6
KEGG IDoca:OCAR_7600, ocg:OCA5_c05430
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.2e-63, Aligned region: 95..311
Protein Sequence: 318 a.a.     [Download]
>gi|209886708|ref|YP_002290565.1| conjugal transfer protein TrbG/VirB9/CagX [Oligotropha carboxidovorans OM5]
MSTPFRKSAFPVLLLSATMLAGCATYKPPQISYDADVPPLPAMPASVTDDRPKPLHIPPAWTPAKGGTAA
GTPVGRVENANAAARVQPRREGYYNAIQIYPWSDGALYQVYAAPGQITDIALEPGESLTGAGPIAAGDTA
RWIIGDTESGSGVTRRVHVLVKPSRADITTNLVITTDRRTYMVELRSGEKPYMPAVAWAYPQSPADRRAG
VPATPIIPVAAARNYRYALTGDTPPWKPVAVYDDGRRVYVEFPRGIVQGEMPPIFVIGADGEAQIVNSRI
YHNILIVDRLFGAAELRLGSGKHQKTVRIVRTDGRPSS
 
Nucleotide Sequence: 957 bp     [Download]
>gi|209883160|ref|NC_011386.1|:c3556624-3555668 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGAGCACGCCTTTCCGTAAATCCGCCTTTCCGGTTTTGCTGCTCTCCGCGACCATGCTCGCAGGCTGCG
CCACCTACAAGCCGCCGCAGATCAGCTACGACGCCGATGTGCCGCCGTTGCCGGCCATGCCCGCATCCGT
CACCGACGATCGGCCAAAGCCGTTGCACATTCCGCCGGCCTGGACGCCGGCGAAGGGCGGCACCGCGGCC
GGCACGCCGGTCGGCCGCGTCGAGAACGCCAATGCTGCCGCCCGTGTGCAGCCGCGCCGCGAAGGTTATT
ACAATGCGATCCAGATTTATCCGTGGAGCGATGGCGCGCTCTATCAGGTCTATGCCGCGCCCGGCCAGAT
CACCGACATCGCGCTCGAACCCGGCGAGAGCCTGACCGGCGCGGGACCGATCGCCGCGGGCGACACCGCC
CGATGGATCATCGGCGACACGGAAAGCGGATCGGGCGTGACGCGCCGGGTGCATGTGCTGGTGAAGCCCT
CGCGTGCCGACATCACCACCAACCTCGTCATTACCACCGATCGGCGCACCTACATGGTCGAGCTGCGCTC
CGGTGAGAAACCCTACATGCCCGCCGTCGCCTGGGCCTATCCGCAATCGCCGGCAGATCGACGCGCGGGC
GTTCCCGCAACCCCAATCATCCCGGTCGCCGCCGCGCGCAACTATCGCTATGCGCTCACCGGCGACACGC
CGCCGTGGAAGCCGGTCGCGGTCTATGACGATGGCCGCAGAGTGTATGTCGAGTTTCCGCGCGGCATCGT
GCAGGGCGAAATGCCGCCGATCTTCGTCATCGGCGCGGACGGCGAAGCGCAGATCGTCAACAGCCGCATC
TACCACAACATCCTGATCGTGGACCGCCTGTTCGGCGCGGCCGAGCTGCGCCTTGGCAGTGGCAAACACC
AGAAAACCGTCAGAATTGTCCGCACGGACGGGAGGCCATCGTCATGA
 Primer design