SecReT4
Protein ID: 209886710
T4SS name [ID]Trb [360]
Gene symboltrbL1
Locus tagOCAR_7602
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]3557307..3558653 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB6JJV8
KEGG IDoca:OCAR_7602, ocg:OCA5_c05410
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-53, Aligned region: 37..262
Protein Sequence: 448 a.a.     [Download]
>gi|209886710|ref|YP_002290567.1| conjugal transfer protein TrbL [Oligotropha carboxidovorans OM5]
MGGSGVIDNFLGTFTRYIDSGFGLLGGEVAFVATTLIVIDVTLAALFWSWGADDDIIARLVKKTLFVGVF
AYLIGNWNNLAHIIFDSFAGLGLKASGTGFTVQDLMRPGKVAQTGLDAARPLLESISDLMGWVAFFENFI
QIACLLFAWALVILAFFILAIQLFVTLIEFKLSTLAGFVLIPFGLFGKTAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFSEFTRGFGGVTPTIDDAMAIVLAALSLVGLGIFGPGIASGLVSGGPQLGAGAVMGTGLA
VGGAAFAAGGGAMLAARGGAAALSGGAAAVRGGATAAGAASAAYSLGSFGQSGASGVASGLGGIARAAGG
AATSPLRRAAGSVKSSFSDGVKSGFGATGGSSTMGTVAGTDDSASASSQATGTPPGWAQRTRRSGHASHA
VQTAAHALRSGDGHGSGSSVNLSESDRS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|209883160|ref|NC_011386.1|:c3558653-3557307 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGGGCGGCTCCGGCGTCATCGACAATTTTCTGGGCACGTTCACGCGCTACATCGACAGTGGGTTCGGCC
TACTCGGCGGCGAGGTTGCGTTCGTCGCCACGACGCTCATCGTCATCGACGTGACCTTGGCCGCGCTGTT
CTGGAGCTGGGGCGCGGACGACGACATTATTGCGCGGCTGGTCAAGAAGACGCTGTTCGTCGGCGTGTTC
GCTTACCTGATCGGCAACTGGAACAACCTGGCGCATATCATCTTCGACAGCTTCGCCGGTCTCGGCCTGA
AGGCGAGCGGCACGGGCTTCACCGTGCAGGATCTGATGCGCCCCGGCAAGGTCGCACAGACCGGCCTCGA
CGCGGCGCGGCCGCTGCTCGAATCCATATCCGACCTGATGGGCTGGGTCGCGTTCTTCGAGAATTTCATC
CAAATCGCGTGCCTGCTGTTCGCCTGGGCACTGGTCATCCTCGCCTTCTTCATTCTGGCGATCCAGCTTT
TCGTGACGCTGATCGAGTTCAAGCTGTCCACGCTGGCCGGCTTCGTTCTCATCCCGTTCGGCCTGTTCGG
CAAGACCGCCTTCATGGCCGAGCGCGTGCTTGGCAATGTGATTTCTTCCGGCATCAAGGTTCTGGTGCTC
GCCGTCATCATCGGCATCGGCTCGACGCTGTTCAGTGAGTTCACGCGCGGCTTTGGCGGCGTCACGCCGA
CCATCGACGACGCCATGGCAATCGTGCTGGCGGCACTTTCGCTGGTCGGACTCGGCATCTTTGGACCTGG
CATCGCATCCGGCCTTGTCTCGGGCGGCCCGCAGCTTGGCGCGGGCGCGGTGATGGGAACGGGCCTTGCC
GTTGGCGGTGCAGCCTTTGCAGCCGGCGGCGGCGCAATGCTGGCCGCGCGAGGCGGAGCCGCCGCATTGT
CTGGAGGCGCAGCCGCCGTGCGCGGTGGCGCGACCGCAGCCGGCGCTGCGTCCGCCGCCTACAGCCTCGG
CTCGTTCGGCCAGTCCGGCGCGTCCGGTGTTGCCTCCGGTCTCGGTGGCATTGCGCGTGCTGCCGGCGGC
GCGGCCACATCGCCGCTTCGCCGTGCCGCTGGAAGCGTCAAATCCAGCTTCTCCGATGGCGTCAAATCTG
GCTTCGGTGCAACCGGCGGCTCATCGACCATGGGCACGGTCGCCGGCACGGACGACAGTGCTTCCGCATC
CTCACAGGCCACGGGGACGCCGCCTGGCTGGGCGCAGCGAACGCGCCGATCCGGCCATGCAAGCCATGCC
GTCCAGACCGCCGCCCACGCCCTGCGCTCCGGCGACGGCCATGGCTCCGGTTCTTCCGTCAACCTCTCCG
AAAGTGACCGCTCATGA
 Primer design