SecReT4
Protein ID: 209886715
T4SS name [ID]Trb [360]
Gene symbol-
Locus tagOCAR_7607
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]3562472..3562804 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB6JJW3
KEGG IDoca:OCAR_7607, ocg:OCA5_c05360
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.8e-24, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|209886715|ref|YP_002290572.1| conjugal transfer protein TrbC [Oligotropha carboxidovorans OM5]
MSHRALRIRHYITTTIATVSISMMLVPAAHASGSSMPWEQPLQQILQSIEGPVAKIVAVIIIIATGLALA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|209883160|ref|NC_011386.1|:c3562804-3562472 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGAGCCATCGTGCCTTGCGTATCCGCCATTACATCACCACGACCATCGCCACCGTATCCATCAGCATGA
TGCTGGTGCCGGCCGCTCATGCCTCCGGCTCGTCGATGCCGTGGGAACAGCCACTTCAGCAAATCCTCCA
GTCGATCGAGGGGCCTGTCGCCAAGATCGTCGCCGTTATCATCATCATCGCGACCGGCCTTGCGCTCGCT
TTCGGCGACACGTCCGGCGGCTTCCGCCGCCTGATCCAGATCGTGTTCGGCCTGTCGATCGCGTTCGCGG
CCAGCTCGTTCTTCTTGAGTTTCTTTTCGTTCGGCGGCGGGGCGTTGGTCTGA
 Primer design