SecReT4
Protein ID: 209886807
T4SS name [ID]VirB [363]
Gene symbol-
Locus tagOCAR_7701
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]3662784..3663500 [+]
Productvirulence protein
Component typeVirB8
UniProt IDB6JK49
KEGG IDoca:OCAR_7701, ocg:OCA5_pOC16701150
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-64, Aligned region: 21..226
Protein Sequence: 238 a.a.     [Download]
>gi|209886807|ref|YP_002290664.1| virulence protein [Oligotropha carboxidovorans OM5]
MTETVTSEPARVDPRYYADGATWERDIARRNRNSRALAWIVATVMSVVAVGALGTLALLVPLKTYEPYMV
VVDKTTGFVEVKRPMAEGPLTQDEAVTTFNVVRYIKARETYDPKALKDNFDLAQLLATGDAARELTEIYS
PANPNNPVKVYGTNTVVAVTIKSVTFPNNRTALARFSTEEKSSTNVITRNWVSLVRFRYTSAPMRNEWRF
DNPLGFQVLEYRRDQETAPSPGTVGAQQ
 
Nucleotide Sequence: 717 bp     [Download]
>gi|209883160|ref|NC_011386.1|:3662784-3663500 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGACGGAAACCGTGACATCAGAGCCCGCGCGCGTCGATCCGCGCTACTATGCCGACGGCGCGACATGGG
AGCGCGACATCGCGCGGCGGAATCGCAACTCCCGCGCGCTGGCCTGGATCGTCGCGACCGTGATGAGCGT
GGTCGCAGTCGGGGCGCTCGGAACACTCGCCCTGCTCGTCCCGCTCAAGACCTACGAGCCTTATATGGTC
GTTGTCGACAAGACGACCGGCTTCGTCGAGGTGAAGCGCCCGATGGCCGAAGGCCCGTTGACCCAGGACG
AAGCGGTGACGACGTTCAACGTCGTCCGTTACATCAAGGCGCGGGAAACTTATGACCCCAAGGCGTTGAA
GGACAACTTCGACCTCGCCCAGCTGCTGGCGACGGGAGACGCAGCGCGTGAGCTCACGGAAATCTACTCG
CCCGCCAATCCGAACAATCCCGTCAAGGTCTACGGCACCAACACTGTTGTCGCGGTCACAATCAAATCCG
TGACCTTCCCGAACAATCGAACCGCGCTGGCGCGGTTTTCGACCGAGGAGAAATCATCGACCAACGTCAT
TACGCGCAACTGGGTCTCGCTCGTGCGGTTCCGCTATACCTCCGCGCCGATGCGCAATGAGTGGCGCTTC
GACAATCCGCTCGGCTTCCAGGTGCTGGAATATCGCCGCGATCAGGAAACGGCGCCGTCGCCCGGAACTG
TGGGTGCGCAACAATGA
 Primer design