SecReT4
Protein ID: 209886810
T4SS name [ID]VirB [363]
Gene symbolvirB
Locus tagOCAR_7704
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_011386] [Browse all T4SS(s) in this replicon]
Location [Strand]3665615..3666673 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB6JK52
KEGG IDoca:OCAR_7704, ocg:OCA5_pOC16701120
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.9e-88, Aligned region: 17..317
Protein Sequence: 352 a.a.     [Download]
>gi|209886810|ref|YP_002290667.1| P-type DNA transfer ATPase VirB11 [Oligotropha carboxidovorans OM5]
MNVLARSLTVFIDRALDPIRTWLDDDHVVEICVNGPAEVWVERFGQAAMERHEVPSLTEHAIRHLAERVA
GHSGQSVNEEHPLLSAALPTGERFQGVMPPATTAGGAFAIRKQVIKEMRLDDYRKLGSFEKVTTAGEGAL
SETDRQLCEHLDAGRIEEFIRLAVVSRYSILLSGGTSSGKTTFLNAILKEVPIEERIITIEDTREVNPIQ
KNYLPLVASKGDQGEARITVETLLQASMRLRPDRIFLGEIRGAEAYSFLRAINTGHPGSITTVHADSPAG
AFEQLALMVMQAGLGLRRDEIVSYIRSVLPIVIQQTKVGGWRGTSAVHFSRMAEWREQRTTGKGRHGARR
RL
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|209883160|ref|NC_011386.1|:3665615-3666673 Oligotropha carboxidovorans OM5 chromosome, complete genome
GTGAACGTGCTGGCGCGAAGTCTGACGGTCTTCATTGACCGCGCACTCGATCCGATCCGCACCTGGCTCG
ATGACGACCATGTCGTCGAGATTTGCGTCAACGGTCCGGCCGAGGTCTGGGTCGAGCGCTTCGGGCAGGC
CGCAATGGAGCGGCACGAGGTGCCGAGCCTAACGGAGCACGCCATCCGGCATCTTGCCGAGCGTGTCGCC
GGACATTCGGGCCAGAGCGTCAACGAGGAGCATCCGTTGCTCTCCGCGGCGCTGCCGACCGGAGAGCGCT
TTCAGGGCGTGATGCCGCCGGCGACGACGGCGGGAGGCGCGTTCGCCATCCGCAAGCAGGTCATCAAGGA
AATGCGGCTCGACGATTACCGCAAGCTCGGTTCATTCGAGAAGGTGACGACGGCGGGGGAGGGCGCGTTG
TCGGAAACCGACCGACAGCTCTGCGAGCATCTCGACGCCGGCCGCATCGAGGAGTTCATCCGGCTCGCCG
TGGTCAGCCGCTACTCGATCTTGCTCTCGGGCGGGACGAGCTCCGGAAAAACAACGTTCCTCAATGCCAT
CCTCAAGGAGGTGCCGATTGAGGAGCGCATCATCACCATCGAGGATACCCGGGAAGTTAACCCGATCCAG
AAAAACTACTTGCCGCTCGTCGCCTCCAAAGGCGATCAAGGGGAGGCCCGCATCACCGTTGAAACGCTGC
TGCAGGCTTCGATGCGGTTACGGCCCGACCGCATCTTTCTCGGCGAAATCCGTGGCGCCGAGGCCTACTC
ATTCTTGCGCGCCATCAATACCGGGCATCCGGGCAGCATCACGACCGTGCACGCCGACAGCCCTGCCGGC
GCCTTCGAGCAACTCGCCTTGATGGTGATGCAGGCCGGGCTCGGCCTGCGCCGCGACGAGATTGTCAGCT
ACATAAGGTCGGTACTGCCGATCGTCATTCAGCAGACAAAGGTCGGTGGATGGCGCGGCACATCGGCGGT
GCATTTCTCGCGCATGGCAGAATGGCGGGAACAGCGGACCACTGGGAAAGGCCGTCATGGCGCGCGTCGT
CGCCTATAG
 Primer design