SecReT4
Protein ID: 209901121
T4SS name [ID]Trw [154]
Gene symbol-
Locus tagpKlebpneu9_p66
StrainKlebsiella pneumoniae plasmid 9 (NC_011383)
Repliconplasmid 9 [GenBank: NC_011383] [Browse all T4SS(s) in this replicon]
Location [Strand]55597..56757 [-]
ProductTraF
Component typeTrwE
UniProt IDB6UZ41
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.3e-54, Aligned region: 202..377
Protein Sequence: 386 a.a.     [Download]
>gi|209901121|ref|YP_002286903.1| TraF [Klebsiella pneumoniae]
MARKSVDVDQELDENTGDGEFESERGGFNGSNRRSAPGMKAFVILMALLALVFIGITVMGKIRAPAKAEA
DKDGGKAQQANTLPNYSFNSDPDVNKPATAQNSATDARAVQAAAQADADAGSSNTGARTSNKRKEPSPEE
LAMQRRLGGELAQTNQAATSNSPGVQPQDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIP
CGTGTELDTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWERIRNDQDGTIV
NIDSAGTNSLGSAGIPGQVDTHMWERLRGAIMISLFSDTLTALVNQTQSNNIQYNSTENSGEQLASEALR
SYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|209901056|ref|NC_011383.1|:c56757-55597 Klebsiella pneumoniae plasmid 9, complete sequence
ATGGCCCGTAAAAGTGTCGATGTAGATCAGGAACTCGATGAAAACACCGGAGACGGTGAATTTGAAAGCG
AGCGTGGCGGATTTAATGGCAGTAACCGCCGTTCGGCTCCTGGTATGAAAGCCTTTGTCATACTGATGGC
GCTGCTTGCTTTGGTATTCATCGGGATTACGGTCATGGGTAAAATTCGCGCCCCGGCTAAAGCTGAAGCT
GATAAAGACGGTGGTAAAGCGCAACAGGCCAATACACTGCCAAACTACAGCTTTAACAGCGATCCTGATG
TTAATAAACCTGCAACTGCGCAGAATAGCGCCACTGATGCCCGTGCTGTGCAGGCTGCCGCACAGGCAGA
TGCAGATGCGGGCAGCAGCAATACCGGCGCGCGTACCTCTAATAAGCGTAAAGAACCTTCGCCTGAAGAA
CTGGCTATGCAGCGTCGTCTGGGCGGCGAGCTGGCCCAGACTAATCAGGCGGCTACAAGCAATAGTCCCG
GAGTGCAGCCCCAGGACAACGAAACAAGCGAAGGTAGTTCAGCACTCGCTAAAAACCTGACTCCTGCAAG
GCTGAAGGCTAGCCGCGCTGGAGTCATGGCTAATCCCAGCCTGACTGTTCCGAAAGGCAAAATGATCCCC
TGTGGTACCGGCACCGAGCTGGATACCACTGTTCCGGGTCAGGTTTCCTGCCGGGTTTCACAGGACGTTT
ACTCAGCTGATGGACTCGTTAGGCTGATTGATAAAGGCTCATGGGTTGACGGGCAGATTACCGGTGGTAT
CAAAGACGGCCAGGCGCGCGTGTTTGTTCTCTGGGAGCGTATCCGCAATGACCAGGACGGAACAATCGTT
AATATTGACAGTGCCGGAACGAACTCACTCGGCAGCGCGGGGATTCCGGGCCAGGTGGATACCCATATGT
GGGAGCGTCTGCGTGGTGCGATCATGATTTCGTTGTTCTCTGACACCTTAACGGCGCTGGTTAACCAGAC
GCAGAGTAATAACATTCAGTACAACAGTACAGAAAACAGCGGTGAGCAGCTGGCGTCTGAAGCACTCCGC
TCTTACATGTCTATCCCCCCTACCCTCTACGATCAGCAGGGTGATGCGGTGAGCATTTTTGTTGCCCGCG
ACCTCGATTTCAGCGGCGTTTATACGCTCGCAGACAACTAA
 Primer design