SecReT4
Protein ID: 209901123
T4SS name [ID]Trw [154]
Gene symbol-
Locus tagpKlebpneu9_p68
StrainKlebsiella pneumoniae plasmid 9 (NC_011383)
Repliconplasmid 9 [GenBank: NC_011383] [Browse all T4SS(s) in this replicon]
Location [Strand]57652..58371 [-]
ProductTraE
Component typeTrwG
UniProt IDB6UZ43
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.9e-53, Aligned region: 31..237
Protein Sequence: 239 a.a.     [Download]
>gi|209901123|ref|YP_002286905.1| TraE [Klebsiella pneumoniae]
MIRKVVQMKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHK
YSQPIPAHLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNV
AESYQSKFKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEY
KSLAMNAEQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 720 bp     [Download]
>gi|209901056|ref|NC_011383.1|:c58371-57652 Klebsiella pneumoniae plasmid 9, complete sequence
TTGATACGCAAGGTGGTGCAAATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGT
TCAACGAAAGCCGTAAAGGGCTTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTG
GATGGTTGCCACCGGTTCAGCGGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTGGTGCATAAG
TACAGCCAGCCAATCCCCGCACATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGC
TGACCCGCGACCAGACCTCTTATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCG
TGAGAGCTATGACTTCTATTCAGTTCAGGTCGACTATACGGCCGTTGGCTTAATGTCCACGCCGAACGTG
GCAGAGTCTTACCAGAGCAAGTTCAAGGGCCGCAACGGTCTTGATAAGGTTCTGGGCGACAGTGAAACGA
CCCGCGTGAAGATTAACTCTGTGATCCTCGATAAACCGCACGGCGTAGCAACGATACGCTTTACTACGGT
TCGCCGCGTGCGCAGCAATCCCGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATAT
AAATCGCTGGCGATGAATGCTGAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCG
TCAACCCGGAAGTTAACTGA
 Primer design