SecReT4
Protein ID: 209901127
T4SS name [ID]Trw [154]
Gene symbol-
Locus tagpKlebpneu9_p72
StrainKlebsiella pneumoniae plasmid 9 (NC_011383)
Repliconplasmid 9 [GenBank: NC_011383] [Browse all T4SS(s) in this replicon]
Location [Strand]59860..60573 [-]
ProductTraC
Component typeTrwJ
UniProt IDB6RFP3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 9.1e-50, Aligned region: 25..216
CENP-Q [PF13094], Evalue: 3.3e-06, Aligned region: 33..137
Protein Sequence: 237 a.a.     [Download]
>gi|209901127|ref|YP_002286909.1| TraC [Klebsiella pneumoniae]
MKKTLTAVLLTTGLILGGAQSASAGIIVTNPTELAKQVEQLQQMAQQLEQLKSQLQTQKNMYESMAKTTN
LGDLLGTSTSTLANNLPDNWKEIYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAITYMNKKLAEKGA
YDRVMAEKAYNNQMQELTDMQELTEQIKTTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKL
LRAQKERATHNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|209901056|ref|NC_011383.1|:c60573-59860 Klebsiella pneumoniae plasmid 9, complete sequence
ATGAAAAAAACACTGACGGCAGTATTGCTGACCACCGGCCTGATTCTGGGAGGCGCGCAAAGCGCTTCCG
CAGGCATCATCGTGACCAACCCTACTGAACTGGCTAAACAGGTCGAGCAGCTTCAGCAAATGGCGCAGCA
GCTGGAGCAGCTTAAAAGCCAGCTGCAAACGCAGAAAAATATGTATGAGTCGATGGCAAAGACAACCAAC
CTGGGCGATCTGCTGGGGACGTCTACCAGCACGCTGGCAAATAATTTGCCGGACAACTGGAAGGAGATTT
ACAGCGACGCCATGAACTCCAGTTCTTCCGTCACGCCTTCAGTTAACAGCATGATGGGCCAGTTTAATGC
GGAAGTTGACGACATGACGCCCAGCGAAGCAATTACCTACATGAACAAAAAGCTGGCTGAAAAAGGCGCT
TATGACCGCGTTATGGCAGAAAAAGCCTACAACAACCAGATGCAGGAACTAACCGATATGCAGGAGCTGA
CGGAGCAGATTAAAACGACTCCAGACCTGAAATCGATTGCTGACTTACAGGCCCGTATCCAGACGTCACA
GGGTGCTATTCAGGGTGAGCAGGCGAAGCTGAATCTGATGAACATGTTGCAGCAGTCACAGGACAAGCTA
TTACGTGCGCAGAAAGAACGTGCCACCCACAATTTTGTTTTTGGAACCGGCGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design