SecReT4
Protein ID: 209901130
T4SS name [ID]Trw [154]
Gene symbol-
Locus tagpKlebpneu9_p75
StrainKlebsiella pneumoniae plasmid 9 (NC_011383)
Repliconplasmid 9 [GenBank: NC_011383] [Browse all T4SS(s) in this replicon]
Location [Strand]63558..63851 [-]
ProductTraM
Component typeTrwL
UniProt IDB6RFP1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|209901130|ref|YP_002286912.1| TraM [Klebsiella pneumoniae]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASFLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|209901056|ref|NC_011383.1|:c63851-63558 Klebsiella pneumoniae plasmid 9, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCGCTGATTGGTATTGGTTCTGCATCATTTCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design