SecReT4
Protein ID: 209901132
T4SS name [ID]Trw [154]
Gene symbol-
Locus tagpKlebpneu9_p77
StrainKlebsiella pneumoniae plasmid 9 (NC_011383)
Repliconplasmid 9 [GenBank: NC_011383] [Browse all T4SS(s) in this replicon]
Location [Strand]64151..64570 [-]
ProductTraL
Component typeTrwN
UniProt IDB6UZ52
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.6e-14, Aligned region: 5..71
Protein Sequence: 139 a.a.     [Download]
>gi|209901132|ref|YP_002286914.1| TraL [Klebsiella pneumoniae]
MGLGLSVDDIFKPCINLRASQTILKACYDSALKSYPAGQVALRHALSCYNTGSLINGISNGYVTKVINVA
RQSTDLKIPTLLPDGQTSEDSTATEPQQAKSTATQYDGEQDVFGSGDGDAFSRNNTDAFLTKQETAKGE
 
Nucleotide Sequence: 420 bp     [Download]
>gi|209901056|ref|NC_011383.1|:c64570-64151 Klebsiella pneumoniae plasmid 9, complete sequence
GTGGGCCTGGGTCTTTCGGTTGACGATATTTTCAAGCCCTGCATCAACCTGCGGGCGAGCCAGACCATCC
TTAAAGCCTGTTATGATAGCGCCCTGAAATCCTATCCAGCCGGGCAGGTTGCGCTGAGACACGCGCTTTC
CTGCTACAACACCGGCTCACTCATAAACGGGATTTCTAACGGGTATGTCACGAAAGTTATCAACGTGGCG
CGTCAATCAACTGATTTGAAAATCCCTACGCTGCTACCTGATGGCCAGACCAGTGAGGACAGCACCGCGA
CTGAGCCTCAGCAGGCAAAAAGTACGGCCACGCAGTATGACGGTGAACAAGATGTTTTTGGTTCGGGTGA
TGGCGATGCCTTCAGCCGAAATAATACGGATGCCTTTTTAACCAAACAGGAAACAGCGAAGGGGGAGTGA
 Primer design