SecReT4
Protein ID: 209901208
T4SS name [ID]Trw [144]
Gene symbol-
Locus tagpKlebpneu12_p64
StrainKlebsiella pneumoniae plasmid 12 (NC_011385)
Repliconplasmid 12 [GenBank: NC_011385] [Browse all T4SS(s) in this replicon]
Location [Strand]52628..53788 [-]
ProductTraF
Component typeTrwE
UniProt IDB6RFP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.3e-54, Aligned region: 202..377
Protein Sequence: 386 a.a.     [Download]
>gi|209901208|ref|YP_002286989.1| TraF [Klebsiella pneumoniae]
MARKSVDVDQELDENTGDGEFESERGGFKGSNRRSAPGMKAFVILMALLALVFIGITVMGKIRTPAKAEA
DKDGGKAQQANTLPNYSFNSDPDVNKPATAQNSATDARAVQAAAQADADAGSSNTAARTSNKRKEPSPEE
LAMQRRLGGELAQTNQAATSNSPGVQPQDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIP
CGTGTELDTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWERIRNDQDGTIV
NIDSAGTNSLGSAGIPGQVDTHMWERLRGAIMISLFSDTLTALVNQTQSNNIQYNSTENSGEQLASEALR
SYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|209901144|ref|NC_011385.1|:c53788-52628 Klebsiella pneumoniae plasmid 12, complete sequence
ATGGCCCGTAAAAGTGTCGATGTAGATCAGGAACTCGATGAAAACACCGGAGACGGTGAATTTGAAAGCG
AGCGTGGCGGATTTAAAGGCAGTAACCGCCGTTCGGCTCCTGGTATGAAAGCCTTTGTCATACTGATGGC
GCTGCTTGCTTTGGTATTCATCGGGATTACGGTCATGGGTAAAATTCGCACCCCGGCTAAAGCTGAAGCT
GATAAAGACGGTGGTAAAGCGCAACAGGCCAATACACTGCCAAACTACAGCTTTAACAGCGATCCTGATG
TTAATAAACCTGCAACTGCGCAGAATAGCGCCACTGATGCCCGTGCTGTGCAGGCTGCCGCACAGGCAGA
TGCAGATGCGGGCAGCAGCAATACCGCCGCGCGTACCTCTAATAAGCGTAAAGAACCTTCGCCTGAAGAA
CTGGCTATGCAGCGTCGTCTGGGCGGCGAGCTGGCCCAGACTAATCAGGCGGCTACAAGCAATAGTCCCG
GAGTGCAGCCCCAGGACAACGAAACAAGCGAAGGTAGTTCAGCACTCGCTAAAAACCTGACTCCTGCAAG
GCTGAAGGCTAGCCGCGCTGGAGTCATGGCTAATCCCAGCCTGACTGTTCCGAAAGGCAAAATGATCCCC
TGTGGTACCGGCACCGAGCTGGATACCACTGTTCCGGGTCAGGTTTCCTGCCGGGTTTCACAGGACGTTT
ACTCAGCTGATGGACTCGTTAGGCTGATTGATAAAGGCTCATGGGTTGACGGGCAGATTACCGGTGGTAT
CAAAGACGGCCAGGCGCGCGTGTTTGTTCTCTGGGAGCGTATCCGCAATGACCAGGACGGGACAATCGTT
AATATTGACAGTGCCGGAACGAACTCACTCGGCAGCGCGGGGATTCCGGGCCAGGTGGATACCCATATGT
GGGAGCGTCTGCGTGGTGCGATCATGATTTCGTTGTTCTCTGACACCTTAACGGCGCTGGTTAACCAGAC
GCAGAGTAATAACATTCAGTACAACAGCACAGAAAACAGCGGTGAGCAGCTGGCGTCTGAAGCACTTCGC
TCTTACATGTCTATCCCCCCTACCCTCTACGATCAGCAGGGTGATGCGGTGAGCATTTTTGTTGCCCGCG
ACCTCGATTTCAGCGGCGTTTATACGCTCGCAGACAACTAA
 Primer design