SecReT4
Protein ID: 209901209
T4SS name [ID]Trw [144]
Gene symbol-
Locus tagpKlebpneu12_p65
StrainKlebsiella pneumoniae plasmid 12 (NC_011385)
Repliconplasmid 12 [GenBank: NC_011385] [Browse all T4SS(s) in this replicon]
Location [Strand]53788..54672 [-]
ProductTraO
Component typeTrwF
UniProt IDB6RFP8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.4e-57, Aligned region: 33..267
Protein Sequence: 294 a.a.     [Download]
>gi|209901209|ref|YP_002286990.1| TraO [Klebsiella pneumoniae]
MKKLLLSAVVLSVLGGAATNVMALEVGRNSPYDYRIKSVVYNPVNVVKIDAIAGVATHIVVAPDETYITH
AFGDSESWTFAHKMNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIETPWAVR
QAVLQLTYEYPFEQQEKAKSAADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFE
FPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAPGAGAVATGT
ASPDVRRVQIGEDN
 
Nucleotide Sequence: 885 bp     [Download]
>gi|209901144|ref|NC_011385.1|:c54672-53788 Klebsiella pneumoniae plasmid 12, complete sequence
ATGAAAAAACTACTTCTTTCAGCAGTCGTTTTGTCAGTCCTGGGAGGCGCGGCCACTAACGTTATGGCGC
TTGAGGTTGGCCGCAATTCTCCTTATGACTATCGCATTAAAAGCGTTGTTTATAACCCTGTTAATGTGGT
CAAAATTGACGCTATCGCCGGTGTGGCTACCCACATTGTTGTCGCGCCTGACGAAACCTATATCACTCAT
GCTTTTGGCGATTCTGAAAGCTGGACGTTTGCGCACAAAATGAACCATTTTTTTGTGAAGCCGAAACAGG
CCATGAGTGATACCAACCTGGTGATCGTCACCGATAAGCGCACCTATAACATCGTCCTCCATTTCATCGG
TGAAGAAACGAAGAAAAATGCAGACGGTACGGTATCAAAATCCTTTATTGAAACGCCGTGGGCTGTGCGC
CAGGCCGTTCTTCAGCTGACCTATGAATATCCGTTTGAGCAGCAGGAAAAAGCCAAAAGCGCGGCTGATA
AAAAACGCATTACGCAGAAGCTGAAGCAGACGGCTTTTGCGGGGGCGAAGAACTATCAGTACGTAATGAG
CGAACAGCCTGAAATGCGCAGCATCCAGCCGGTTCACGTCTGGGATAACTACCGCTTTACCCGGTTTGAG
TTTCCGGCCAATGCGGAGTTACCGCAGGTCTACATGATCTCGGCCAGTGGCAAAGAAACGCTGCCTAACT
CTCATGTTGTGGGTGAGAACCGCAACATCATCGAGGTGGAAACCGTCGCTAAAGAGTGGCGTATTCGTCT
GGGCGATAAAGTCGTTGGCGTTCGTAATAATAATTTCGCGCCGGGCGCCGGTGCGGTAGCAACCGGTACG
GCTTCCCCGGATGTGCGCAGGGTTCAAATTGGGGAGGATAACTGA
 Primer design