SecReT4
Protein ID: 209901211
T4SS name [ID]Trw [144]
Gene symbol-
Locus tagpKlebpneu12_p67
StrainKlebsiella pneumoniae plasmid 12 (NC_011385)
Repliconplasmid 12 [GenBank: NC_011385] [Browse all T4SS(s) in this replicon]
Location [Strand]55371..55529 [-]
Producthypothetical protein
Component typeTrwH
UniProt IDB6UYS6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 52 a.a.     [Download]
>gi|209901211|ref|YP_002286992.1| hypothetical protein pKlebpneu12_p67 [Klebsiella pneumoniae]
MDAVMRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGANES
 
Nucleotide Sequence: 159 bp     [Download]
>gi|209901144|ref|NC_011385.1|:c55529-55371 Klebsiella pneumoniae plasmid 12, complete sequence
ATGGATGCCGTAATGCGCAGCTTATTGCTTATGGGAGTTCTTCTGATTAGCGCCTGTTCCAGCGGGCATA
AACCGCCACCGGAGCCGGACTGGAGCAACACCGTTCCAGTAAACAAAACAATCCCGGTTGATACGCAAGG
TGGTGCAAATGAAAGCTAA
 Primer design