SecReT4
Protein ID: 209901214
T4SS name [ID]Trw [144]
Gene symbol-
Locus tagpKlebpneu12_p70
StrainKlebsiella pneumoniae plasmid 12 (NC_011385)
Repliconplasmid 12 [GenBank: NC_011385] [Browse all T4SS(s) in this replicon]
Location [Strand]56891..57604 [-]
ProductTraC
Component typeTrwJ
UniProt IDB6RFP3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 9.1e-50, Aligned region: 25..216
CENP-Q [PF13094], Evalue: 3.3e-06, Aligned region: 33..137
Protein Sequence: 237 a.a.     [Download]
>gi|209901214|ref|YP_002286995.1| TraC [Klebsiella pneumoniae]
MKKTLTAVLLTTGLILGGAQSASAGIIVTNPTELAKQVEQLQQMAQQLEQLKSQLQTQKNMYESMAKTTN
LGDLLGTSTSTLANNLPDNWKEIYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAITYMNKKLAEKGA
YDRVMAEKAYNNQMQELTDMQELTEQIKTTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKL
LRAQKERATHNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|209901144|ref|NC_011385.1|:c57604-56891 Klebsiella pneumoniae plasmid 12, complete sequence
ATGAAAAAAACACTGACGGCAGTATTGCTGACCACCGGCCTGATTCTGGGAGGCGCGCAAAGCGCTTCCG
CAGGCATCATCGTGACCAACCCTACTGAGCTGGCTAAACAGGTCGAGCAGCTTCAGCAAATGGCGCAGCA
GCTGGAGCAGCTTAAAAGCCAGCTGCAAACGCAGAAAAATATGTATGAGTCGATGGCAAAGACAACCAAC
CTGGGCGATCTGCTGGGGACGTCTACCAGCACGCTGGCAAATAATTTGCCGGACAACTGGAAGGAGATCT
ACAGCGACGCCATGAACTCCAGTTCTTCCGTCACGCCTTCAGTTAACAGCATGATGGGCCAGTTTAATGC
GGAAGTTGACGACATGACGCCCAGCGAAGCAATTACCTACATGAACAAAAAGCTGGCTGAAAAAGGCGCT
TATGACCGCGTTATGGCAGAAAAAGCCTACAACAACCAGATGCAGGAACTAACCGATATGCAGGAGCTGA
CGGAGCAGATTAAAACGACTCCAGACCTGAAATCGATTGCTGACTTACAGGCCCGTATCCAGACGTCACA
GGGTGCTATTCAGGGTGAGCAGGCGAAGCTGAATCTGATGAACATGTTGCAGCAGTCACAGGACAAGCTA
TTACGTGCGCAGAAAGAACGTGCCACCCACAATTTTGTTTTTGGAACCGGCGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design