SecReT4
Protein ID: 209901226
T4SS name [ID]Trw [144]
Gene symbol-
Locus tagpKlebpneu12_p82
StrainKlebsiella pneumoniae plasmid 12 (NC_011385)
Repliconplasmid 12 [GenBank: NC_011385] [Browse all T4SS(s) in this replicon]
Location [Strand]69401..69694 [-]
ProductTraM
Component typeTrwL
UniProt IDB6RFP1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|209901226|ref|YP_002287007.1| TraM [Klebsiella pneumoniae]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASFLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|209901144|ref|NC_011385.1|:c69694-69401 Klebsiella pneumoniae plasmid 12, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCGCTGATTGGTATTGGTTCTGCATCATTTCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design