SecReT4
Protein ID: 209901228
T4SS name [ID]Trw [144]
Gene symbol-
Locus tagpKlebpneu12_p84
StrainKlebsiella pneumoniae plasmid 12 (NC_011385)
Repliconplasmid 12 [GenBank: NC_011385] [Browse all T4SS(s) in this replicon]
Location [Strand]69994..70728 [-]
ProductTraL
Component typeTrwN
UniProt IDB6RFN9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 6.7e-34, Aligned region: 31..176
Protein Sequence: 244 a.a.     [Download]
>gi|209901228|ref|YP_002287009.1| TraL [Klebsiella pneumoniae]
MSKHPKLLVLALACLACAGRASAAPASDEVARLAQRCAPDVSPLTMAYIVGHESSNGPYRININGSIQLK
QQPRTEAEAVSVAKVLLKDNKSFDMGLAQINSNNLVGLGLSVDDIFKPCINLRASQTILKACYDSALKSY
PAGQVALRHALSCYNTGSLTNGISNGYVTKVINVARQSTDLKIPTLLPDGQTSEDSTATEPQQAKSTAPQ
YDGEQDVFGSGDGDAFSRNNTDAFLTRQETAKGE
 
Nucleotide Sequence: 735 bp     [Download]
>gi|209901144|ref|NC_011385.1|:c70728-69994 Klebsiella pneumoniae plasmid 12, complete sequence
ATGAGTAAACATCCAAAACTCCTGGTTCTCGCTCTGGCCTGCCTTGCTTGTGCTGGCCGTGCCAGTGCTG
CGCCTGCCTCCGATGAAGTTGCCAGGCTTGCGCAGAGATGTGCGCCTGATGTTTCACCCTTAACGATGGC
GTACATCGTCGGCCATGAGTCCTCAAATGGGCCGTACAGGATCAATATTAACGGTAGTATTCAGTTAAAA
CAGCAACCGCGTACTGAAGCTGAGGCCGTCAGCGTTGCGAAAGTTCTGCTGAAGGATAATAAAAGTTTTG
ATATGGGCCTTGCACAAATTAACTCAAATAATTTAGTGGGCCTGGGTCTTTCGGTTGACGATATTTTCAA
ACCCTGCATCAACCTGCGGGCGAGCCAGACCATCCTTAAAGCCTGTTATGATAGCGCCCTGAAATCCTAC
CCAGCCGGGCAGGTTGCGCTGAGACACGCGCTTTCCTGCTACAACACCGGCTCACTCACAAACGGGATTT
CTAACGGGTATGTCACGAAAGTTATCAACGTGGCGCGTCAATCAACTGATTTGAAAATCCCTACGCTGCT
ACCTGACGGCCAGACCAGTGAGGACAGCACCGCGACTGAGCCTCAGCAGGCAAAAAGTACGGCGCCGCAG
TATGACGGTGAACAAGATGTTTTTGGTTCGGGTGATGGCGATGCCTTCAGCCGAAATAATACGGATGCCT
TTTTAACCAGACAGGAAACAGCGAAGGGGGAATGA
 Primer design