SecReT4
Protein ID: 209916888
T4SS name [ID]Tra_F [117]
Gene symbol-
Locus tagECSE_P2-0059
StrainEscherichia coli SE11
Repliconplasmid pSE11-2 [GenBank: NC_011413] [Browse all T4SS(s) in this replicon]
Location [Strand]42387..42686 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB6ICF1
KEGG IDecy:ECSE_P2-0059
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.3e-26, Aligned region: 7..99
Protein Sequence: 99 a.a.     [Download]
>gi|209916888|ref|YP_002291208.1| conjugal transfer pilus assembly protein TraL [Escherichia coli SE11]
MSGEVEDRYIFPQTLTEQKRLIGIPLDEASVGLTPACVGIYFNQSLVGLIVGLLFWFALTHFKKGKGTSW
LFNMCYWHLPGLNGQFKVLPESAWRLWLK
 
Nucleotide Sequence: 300 bp     [Download]
>ref|NC_011413.1|:42387-42686 conjugal transfer pilus assembly protein TraL [Escherichia coli SE11]
ATGAGCGGTGAAGTGGAAGATCGTTACATCTTTCCTCAGACGCTGACCGAACAGAAACGCCTCATCGGGA
TACCTCTCGATGAGGCGTCTGTTGGCCTGACACCGGCCTGTGTCGGAATTTACTTTAACCAGAGCCTGGT
CGGGTTGATTGTTGGTCTTCTGTTCTGGTTTGCGTTGACCCATTTCAAAAAAGGGAAGGGCACTTCCTGG
CTTTTTAACATGTGTTACTGGCATCTGCCAGGGCTGAACGGGCAGTTTAAGGTGCTGCCGGAATCGGCCT
GGCGTCTGTGGCTTAAGTAA
 Primer design