SecReT4
Protein ID: 209916902
T4SS name [ID]Tra_F [117]
Gene symbol-
Locus tagECSE_P2-0073
StrainEscherichia coli SE11
Repliconplasmid pSE11-2 [GenBank: NC_011413] [Browse all T4SS(s) in this replicon]
Location [Strand]54716..55489 [+]
ProductTraF protein
Component typeTraF_F
UniProt IDB6ICG5
KEGG IDecy:ECSE_P2-0073
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.6e-79, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|209916902|ref|YP_002291222.1| TraF protein [Escherichia coli SE11]
MLYLVATISLLISGQTGAQREPVRTYVDEPIVGWHWYNEPQKQDEEEIPPPATVPLTSLPPTAQMKVLQR
MTEERLNTAILYPTVENFTAYMKMQNFWTSQASRFSAVATKSLLMHPELDYNLQYSHYNSTVPLQLQADQ
NRQVAAIRQLASQYGLFFFYRGNDALDGELAKVVQRFSDEYNVALIPVSMDGARSEALPQTRPDSGQAQR
LGVTHLPALFLVEPGAERYQPLAYGFMTQDDLMKRFLSVATDFAPRS
 
Nucleotide Sequence: 774 bp     [Download]
>ref|NC_011413.1|:54716-55489 TraF protein [Escherichia coli SE11]
ATGCTGTATCTGGTTGCGACAATAAGTCTGCTGATATCCGGTCAGACAGGTGCGCAACGTGAACCGGTCC
GTACCTATGTGGACGAACCGATAGTGGGCTGGCACTGGTACAACGAACCTCAGAAACAGGATGAGGAGGA
AATACCTCCACCGGCCACTGTTCCCCTGACATCTCTTCCTCCGACAGCACAGATGAAGGTCCTTCAGCGA
ATGACAGAGGAGCGGCTGAATACCGCCATTCTCTACCCGACAGTGGAGAATTTTACGGCCTACATGAAGA
TGCAGAACTTCTGGACCAGTCAGGCCAGTCGCTTCAGTGCCGTGGCCACCAAATCCCTGCTGATGCATCC
GGAACTGGATTACAACCTGCAGTACAGTCACTACAACAGCACAGTTCCGCTGCAGCTGCAGGCTGACCAG
AACCGTCAGGTGGCTGCCATTCGTCAGCTGGCCAGTCAGTACGGGCTGTTCTTCTTTTACCGGGGGAATG
ATGCACTGGATGGTGAGCTTGCAAAGGTGGTGCAGCGTTTCTCTGATGAATACAACGTTGCACTGATTCC
GGTCAGTATGGACGGTGCCCGGAGCGAGGCACTGCCGCAGACGCGTCCTGACAGCGGGCAGGCTCAGCGG
CTGGGCGTGACGCATCTGCCGGCACTTTTCTTGGTTGAACCGGGGGCAGAGCGTTACCAGCCGCTGGCTT
ATGGCTTTATGACGCAGGATGACCTGATGAAACGATTTTTAAGTGTGGCGACAGATTTTGCGCCACGGTC
GTGA
 Primer design