SecReT4
Protein ID: 209916913
T4SS name [ID]Tra_F [117]
Gene symbol-
Locus tagECSE_P2-0084
StrainEscherichia coli SE11
Repliconplasmid pSE11-2 [GenBank: NC_011413] [Browse all T4SS(s) in this replicon]
Location [Strand]71350..72102 [+]
ProductTraX protein
Component typeTraX_F
UniProt IDB6ICH6
KEGG IDecy:ECSE_P2-0084
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 4e-42, Aligned region: 27..245
Protein Sequence: 250 a.a.     [Download]
>gi|209916913|ref|YP_002291233.1| TraX protein [Escherichia coli SE11]
MENQECFCKDDVRNPGALPLLSLAPLQRDIIKIVAFLAMTGDHIATAFHVGTPWLNLTGRCAFPLFALMA
GCNLAGRQIRQAAVNRLWLMAVLAQPVFWLAFCGTGNQWWELNILFCFAVVMQVVCFWQRPDAIKGAITG
TMLALYLPFSTASYGWQGLVMLLAAVSVWQVPEQYQGRLFLLWLCSVVWLNGANGAVPVLAGMGMTLLVL
CLVHEYVPSSSKRLQISRWFAEGYVLHLLIIAVIVYGLQT
 
Nucleotide Sequence: 753 bp     [Download]
>ref|NC_011413.1|:71350-72102 TraX protein [Escherichia coli SE11]
ATGGAAAACCAGGAATGTTTCTGCAAGGATGATGTACGGAATCCCGGTGCTTTGCCTTTGCTGTCTCTGG
CACCATTACAACGTGACATTATCAAAATCGTGGCATTTCTGGCGATGACAGGTGACCACATTGCTACAGC
ATTTCATGTGGGGACTCCCTGGCTTAACCTGACCGGGCGGTGCGCATTCCCACTTTTCGCACTGATGGCG
GGCTGCAACCTGGCGGGGCGGCAGATACGACAGGCTGCCGTAAATCGCCTGTGGCTGATGGCAGTGCTGG
CGCAACCGGTATTCTGGCTGGCATTTTGTGGTACAGGAAATCAGTGGTGGGAACTGAACATTCTGTTCTG
CTTTGCCGTGGTGATGCAGGTGGTCTGTTTCTGGCAACGCCCTGATGCCATAAAAGGTGCCATAACCGGA
ACCATGCTGGCACTGTATCTGCCGTTCAGTACTGCCAGTTATGGCTGGCAGGGACTGGTGATGCTGCTGG
CAGCTGTATCCGTCTGGCAGGTGCCGGAGCAGTACCAGGGGCGGTTATTTTTACTGTGGCTGTGCTCTGT
TGTATGGCTGAACGGTGCAAACGGGGCAGTCCCCGTGCTGGCCGGTATGGGCATGACACTGCTGGTATTG
TGTCTGGTGCATGAGTATGTACCTTCATCATCAAAGCGCCTGCAGATAAGCCGGTGGTTTGCAGAAGGTT
ATGTCCTGCATCTGCTGATTATTGCCGTCATTGTTTATGGGCTGCAGACTTAA
 Primer design