SecReT4
Protein ID: 209922040
T4SS name [ID]Tra_I [169]
Gene symbol-
Locus tagECSE_P1-0088
StrainEscherichia coli SE11
Repliconplasmid pSE11-1 [GenBank: NC_011419] [Browse all T4SS(s) in this replicon]
Location [Strand]63908..66952 [-]
ProductTraU protein
Component typeTraU_I
UniProt IDB6IC56
KEGG IDecy:ECSE_P1-0088
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.7e-46, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|209922040|ref|YP_002296113.1| TraU protein [Escherichia coli SE11]
MNINRLIFTIEDCLNTLSRFSVASSFVEYCDLRTVIGLDRQDRERRPWLNSPYIAATKRGEYLSVFEVSG
AFREMDEASDQTGPGSLESLITSMSDSLNTAYKNSGHKISCVFERDPEMGKEEIEDMVAPQKRSLANTGI
QLQDVVDEKVTTLSPWLVRERCWLAIWSGPDLISNSDRTAHDELVRRLAERVPKARFAQSPWQWTLSALK
IRHEAFLDNVEQALRHSSDGLILRLLDIHEVGREIRRQTERYSTPRNWQPHLPEDAQPAGYRWTDDESVL
HAPSLHLQLFNTQVTTQGNLVQAGGLWHGMVSITLPPQNLQTFNELVRAVPRAVPWRIRMDLMPGGMKAL
NLKKTLLTYSSFISAVRPMYESVMTLAATDEKEPVCIMTIMASTWGKTREICARNQAILKSAIEGWGVCG
TTTTFGDPRRAWVNTILAASGGSGPVPLYPPLSHAISLFPLNRAGSVWRGKGNLMLHTEDGSAFEVGLAS
SQQNKHTELAPGDPGLGKSVLINTLSEIQISSAQKNLPFIAYIDKGYSAQGLVQLIRDSLPPERKDEAVG
IILSNDPEYTRNLFDVMYGAKKPITPEKNFMSSVLCALCVDTGTGQPCNPGDTRQIINQLIELAFKEYGE
NNPRLYRASTEELVDSALQDSGLYEKHDATWWARSTWFEVRDMLHNAGYIMAAQRAHYQAMPQLPEVSSM
LGHTSLRDVFGTVQRDGSNELLLDYIRRALEQGHNDYPMISGYTRFMINPETRVIAVDLNNVAGDKTPAG
RLKTGIMYLLAGQIAGGDFTLPQYRDEVLKQLPREYHEIALKRINQLDQEVKTKVYDELHNARGIDFIWE
NLDTQEREQRKFAIRTVLSTQYLRDYPESVLKSANTLWLLRYKPEDIPVLRDNFNVPEFMLKRFLKMPEG
PAPDGSGVPVLGVFRVKSGTLARILKFTVGPLELWALNSSPKDSALRKTLTNKLGSVRARKILAENFPRG
SATSLIEHRAGQHNSDNVIEELASELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>ref|NC_011419.1|:c66952-63908 TraU protein [Escherichia coli SE11]
ATGAACATAAACCGTTTAATCTTCACTATCGAAGACTGTCTGAACACGCTATCCCGTTTCTCTGTCGCAA
GCAGTTTTGTTGAGTATTGCGATTTACGTACTGTAATTGGTCTGGACAGACAGGATCGTGAACGTCGCCC
ATGGCTGAATTCGCCCTATATTGCAGCCACAAAGCGTGGAGAATATCTCTCTGTCTTTGAAGTCAGCGGT
GCGTTCAGGGAAATGGATGAAGCATCCGACCAGACTGGCCCAGGTTCACTGGAATCGCTGATCACCAGCA
TGAGTGACAGCCTGAATACGGCATATAAAAACAGCGGTCATAAAATCAGCTGCGTTTTCGAGCGTGACCC
TGAAATGGGGAAAGAGGAAATCGAAGACATGGTCGCCCCACAAAAACGCTCACTGGCTAATACAGGTATC
CAGTTACAGGATGTGGTCGATGAGAAAGTCACAACACTGTCCCCATGGCTGGTCCGGGAGCGTTGCTGGC
TGGCGATCTGGAGTGGACCCGACCTTATCAGCAACAGCGATCGCACTGCCCATGATGAGCTTGTCAGAAG
ACTGGCTGAACGGGTACCGAAAGCACGCTTTGCCCAGTCCCCCTGGCAGTGGACCTTATCTGCACTGAAA
ATCCGCCACGAAGCTTTTCTTGATAATGTGGAACAGGCACTGAGACATTCATCTGATGGCCTGATTCTCC
GGCTTCTGGATATACACGAAGTCGGGCGTGAAATACGTCGTCAGACAGAACGGTACAGCACACCGCGTAA
CTGGCAACCCCACCTGCCTGAAGATGCCCAGCCAGCAGGATATCGCTGGACTGACGATGAATCCGTACTA
CATGCTCCTTCATTGCATTTGCAGTTATTCAACACGCAGGTGACCACACAGGGCAACCTGGTTCAGGCGG
GCGGACTCTGGCACGGAATGGTATCGATTACTTTACCTCCGCAAAATCTGCAGACGTTTAACGAACTGGT
CCGTGCCGTCCCCCGCGCAGTCCCCTGGCGCATCAGAATGGATCTGATGCCCGGCGGGATGAAGGCTCTT
AATCTGAAGAAAACGCTTCTGACTTACAGCAGCTTCATTTCTGCCGTTCGTCCAATGTATGAATCCGTTA
TGACCCTGGCGGCAACGGATGAAAAAGAACCTGTCTGCATAATGACCATCATGGCCTCCACGTGGGGAAA
AACACGTGAAATATGCGCACGAAACCAGGCCATTCTGAAATCGGCCATTGAAGGCTGGGGCGTATGTGGC
ACCACGACAACATTTGGCGATCCCCGGCGCGCCTGGGTGAATACCATTCTCGCGGCATCCGGAGGCTCCG
GCCCGGTTCCCCTGTATCCCCCGTTGTCACATGCCATCTCGCTTTTCCCGCTTAACAGGGCAGGCTCTGT
CTGGCGAGGCAAAGGGAATCTGATGTTACATACAGAAGACGGTTCCGCATTTGAGGTTGGTCTGGCGTCA
TCCCAACAAAATAAACATACAGAACTGGCACCAGGCGATCCGGGACTGGGTAAATCAGTTCTGATTAATA
CGTTGTCGGAAATACAGATATCATCTGCTCAGAAAAACCTGCCCTTCATTGCCTATATCGATAAGGGATA
CAGTGCTCAGGGACTGGTTCAGCTTATTCGCGACAGTCTTCCTCCGGAAAGAAAAGACGAAGCTGTCGGT
ATTATTCTGAGCAATGATCCGGAATACACCCGTAACCTTTTTGACGTGATGTACGGCGCTAAAAAGCCTA
TTACGCCGGAAAAGAATTTCATGTCATCGGTACTGTGTGCTCTCTGTGTCGATACCGGTACCGGTCAACC
CTGTAACCCCGGAGACACCCGACAAATTATCAACCAGCTTATCGAGCTGGCTTTTAAAGAGTACGGTGAA
AATAATCCGCGACTTTATCGCGCCTCAACGGAAGAACTGGTGGATTCAGCACTGCAGGACTCGGGACTGT
ATGAAAAACATGATGCAACCTGGTGGGCCAGATCAACCTGGTTCGAAGTCCGGGATATGCTCCACAATGC
CGGGTATATCATGGCGGCTCAGCGGGCACATTATCAGGCAATGCCCCAGCTTCCCGAAGTGTCCTCGATG
CTGGGCCATACCAGTCTCAGGGATGTTTTCGGTACTGTTCAGCGTGATGGTTCAAACGAACTTCTGCTGG
ACTACATCCGCCGCGCTCTCGAGCAGGGACATAACGACTACCCCATGATATCCGGGTATACCCGGTTTAT
GATCAACCCGGAAACCCGGGTCATCGCTGTCGATCTGAATAATGTTGCCGGTGACAAAACGCCTGCAGGC
AGGCTTAAAACCGGCATCATGTACCTGCTTGCAGGTCAGATCGCCGGTGGTGACTTCACCCTGCCACAAT
ACAGGGATGAAGTGTTAAAGCAGCTTCCACGGGAATACCATGAAATCGCTCTTAAACGTATTAACCAACT
TGATCAGGAGGTTAAGACAAAAGTTTATGATGAACTGCATAACGCCCGGGGCATTGACTTCATCTGGGAA
AATCTGGATACCCAGGAGCGTGAGCAACGCAAGTTTGCTATCCGCACGGTTCTGAGTACGCAGTATCTGA
GGGACTACCCGGAAAGCGTTCTTAAGTCAGCAAATACTCTCTGGTTACTGCGCTACAAACCCGAAGATAT
CCCCGTACTGAGGGATAACTTCAACGTTCCTGAATTTATGCTGAAACGCTTCCTGAAAATGCCGGAAGGC
CCGGCACCAGATGGTAGTGGTGTTCCTGTTCTGGGAGTATTCAGGGTAAAAAGTGGCACGCTTGCGAGAA
TACTCAAATTTACCGTCGGTCCACTGGAGCTATGGGCGCTGAACTCATCGCCAAAAGACAGTGCCCTGCG
TAAAACACTGACAAATAAGTTAGGTTCAGTTCGGGCACGTAAGATTCTGGCCGAAAACTTCCCCAGAGGT
TCTGCAACGTCATTAATTGAGCACCGGGCGGGCCAACATAACAGTGACAATGTTATTGAAGAACTGGCCT
CAGAACTCATCCGAAAACAGGGATACAATCTCTGA
 Primer design