SecReT4
Protein ID: 209922048
T4SS name [ID]Tra_I [169]
Gene symbol-
Locus tagECSE_P1-0096
StrainEscherichia coli SE11
Repliconplasmid pSE11-1 [GenBank: NC_011419] [Browse all T4SS(s) in this replicon]
Location [Strand]72049..72741 [-]
ProductTraM protein
Component typeTraM_I
UniProt IDB6IC64
KEGG IDecy:ECSE_P1-0096
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 2e-34, Aligned region: 77..184
Protein Sequence: 230 a.a.     [Download]
>gi|209922048|ref|YP_002296121.1| TraM protein [Escherichia coli SE11]
MTENTELSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKALLCTGTCLLISITGNAIQYWHSTNVER
EYFATDNGRLVRLAPTNQPAWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFAGYVNALQA
SNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPR
LKPSGMEIRQMISRNAGPNS
 
Nucleotide Sequence: 693 bp     [Download]
>ref|NC_011419.1|:c72741-72049 TraM protein [Escherichia coli SE11]
ATGACCGAAAATACCGAGCTATCCTCGCCATCACATCCGGCACCTGACCCGGAAATACTGAAGAGCACAA
TCAGGGCTATGAAGCAGTCAGAACAGCGGGCAAATAATGTCCCTGCGCTGATAAAAGCGCTTTTATGTAC
GGGCACATGTCTTCTTATCAGTATTACTGGTAACGCCATTCAGTACTGGCACTCAACGAATGTGGAGCGC
GAATATTTCGCTACAGACAATGGTCGTCTGGTCAGGCTGGCACCAACAAATCAGCCAGCATGGAGTCAGA
ATGATGCAATGGCCTTTGGCAGCCAGGCACTGGCGACCGCATTCAACCTGGATTTTGTGCACTATCGTTC
ACAGATCTCCTCCCTGTCTCCGCGTTTTTCTGACGAAGGTTTTGCCGGATATGTGAATGCATTACAGGCA
TCTAACATTCTGGAGACGATCAAGAAAGAGAAGATGAATCTGACCGCCACGACAGGTGCTGGCGTTCTGG
TACGACAGGGACAAATGTCCGACGGCGTATGGTTCTGGACATTCCAGTATCCTGTCCGTATGCGTCTGGT
CGGCCAGACAACCAGCAAGCCAGAACAGTCTTTTGTTTTCGAAATCACCATCCAGCGTGTTGACCCCAGA
CTGAAACCATCCGGTATGGAAATCCGGCAGATGATCTCCCGTAACGCCGGACCGAACTCCTGA
 Primer design