SecReT4
Protein ID: 209922049
T4SS name [ID]Tra_I [169]
Gene symbol-
Locus tagECSE_P1-0097
StrainEscherichia coli SE11
Repliconplasmid pSE11-1 [GenBank: NC_011419] [Browse all T4SS(s) in this replicon]
Location [Strand]72738..73085 [-]
ProductTraL protein
Component typeTraL_I
UniProt IDB6IC65
KEGG IDecy:ECSE_P1-0097
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|209922049|ref|YP_002296122.1| TraL protein [Escherichia coli SE11]
MNMHKSLVAVLGLILISSTASAATCRAGSAAQAGSNTGYERARAAADAWSQRENDVSSSLQSCLSRIKKI
SINLPQFPSLDDILSQLENQVCDAVVDKVNEKLPGNIDPWKDYNL
 
Nucleotide Sequence: 348 bp     [Download]
>ref|NC_011419.1|:c73085-72738 TraL protein [Escherichia coli SE11]
ATGAACATGCATAAGTCTCTGGTTGCCGTGCTCGGCCTTATCCTGATTTCATCCACGGCAAGTGCTGCAA
CCTGTCGTGCGGGTAGCGCGGCACAGGCCGGTAGTAATACAGGATATGAGCGAGCACGTGCAGCTGCGGA
TGCATGGTCACAACGTGAAAACGATGTTTCCTCATCCCTGCAGTCCTGTCTGTCACGAATCAAAAAAATC
AGCATAAACCTCCCCCAGTTCCCCAGCCTTGACGACATTCTGTCGCAGCTGGAAAACCAGGTCTGCGACG
CGGTCGTGGACAAGGTGAATGAAAAGCTGCCGGGGAATATTGATCCCTGGAAGGACTACAACCTATGA
 Primer design