SecReT4
Protein ID: 209947546
T4SS name [ID]Tfc [45]
Gene symbolpilL
Locus tagp1056.31
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]27852..28481 [+]
Productputative lipoprotein precursor
Component typeTfc2
UniProt IDQ6A279
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 209 a.a.     [Download]
>gi|209947546|ref|YP_002291043.1| putative lipoprotein precursor [Haemophilus influenzae]
MKKILLTTFALVVLSGCAHKQQTADEQQALENPNIQQGQHQVLQPEDRIVRPDIYTDYQPERTEVLREGR
YTLINFSPEEGQKYLLDQSVTVNMLGKKKRALTATVEQGLRTTLKDTGLSLCHGFGQNEPTLSTLYSRPL
PKVHYQFGPMALRDALQMLAGPAYEITINDVSRTVCFKLRPAVPERATGEKPKVETTTTTTTTTEIIEE
 
Nucleotide Sequence: 630 bp     [Download]
>gi|209947517|ref|NC_011409.1|:27852-28481 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGAAAAAAATTCTATTAACCACTTTTGCATTGGTTGTGCTTTCAGGTTGTGCACATAAACAACAAACAG
CCGATGAGCAACAAGCACTAGAAAATCCAAATATTCAACAAGGTCAGCATCAAGTTTTACAACCGGAAGA
TAGAATTGTTCGTCCGGATATTTACACAGACTATCAGCCTGAACGTACAGAAGTGTTACGTGAAGGTCGA
TACACTTTAATTAATTTCTCTCCGGAAGAAGGTCAAAAATACCTTCTAGACCAAAGTGTCACTGTCAACA
TGTTAGGTAAAAAGAAACGAGCCTTAACGGCAACCGTTGAGCAGGGATTACGCACGACGTTAAAAGATAC
AGGCCTTTCACTTTGCCATGGCTTTGGTCAGAATGAACCAACACTTTCTACGCTTTATTCCCGTCCATTA
CCAAAAGTACATTATCAATTTGGCCCGATGGCTTTACGTGATGCCCTTCAAATGTTAGCAGGGCCGGCTT
ATGAAATTACTATCAATGACGTTTCTCGTACCGTTTGTTTTAAATTACGCCCAGCTGTACCGGAACGTGC
TACAGGGGAAAAGCCGAAAGTAGAAACCACAACAACGACAACAACCACAACAGAAATCATCGAGGAATAA
 Primer design