SecReT4
Protein ID: 209947547
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.32
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]28485..29225 [+]
Productputative exported protein precursor
Component typeTfc3
UniProt IDQ6A278
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 246 a.a.     [Download]
>gi|209947547|ref|YP_002291044.1| putative exported protein precursor [Haemophilus influenzae]
MNHVKKISYVAMILGMFSTAVFADVTAANTLATQSLNQQNLVTNKLNQQELLAKSQEWGLTEQEWQRYQE
LNQGARGIWSPGLDPLTSLGVESRNEQERERYARLLAKKMHDRMERELQFQRTYDRVFAEMYPNEQPFKV
EPHISERFGRVIYFTRLENCDKCEANADRVLQYVNDKTPIDIYFVGVKNNEQIYNWAKKHNIDPNKVNRK
LITLNHDNGAWLQYADGKMPAAFQIQQDGQWQQIVY
 
Nucleotide Sequence: 741 bp     [Download]
>gi|209947517|ref|NC_011409.1|:28485-29225 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGAATCATGTTAAAAAAATATCCTATGTGGCGATGATATTAGGGATGTTTTCTACTGCTGTATTTGCTG
ATGTCACAGCAGCGAATACGCTGGCTACTCAATCCTTAAACCAGCAAAACTTGGTGACAAATAAATTAAA
TCAACAAGAGTTATTAGCTAAGTCTCAGGAGTGGGGTTTAACTGAGCAAGAATGGCAACGCTACCAAGAG
CTTAATCAAGGTGCTCGTGGTATATGGTCGCCAGGTCTTGACCCTTTAACCTCGCTTGGTGTGGAGTCTC
GAAATGAGCAGGAAAGAGAGCGTTATGCTCGACTACTGGCAAAAAAAATGCACGACCGCATGGAGCGAGA
GCTGCAGTTCCAACGCACTTATGATCGCGTATTTGCTGAAATGTATCCAAATGAGCAACCATTTAAGGTT
GAACCTCATATTTCAGAGCGGTTTGGACGGGTGATTTATTTTACTCGCCTAGAAAATTGTGACAAATGTG
AAGCGAATGCTGATCGTGTACTGCAATATGTGAATGATAAAACGCCTATAGATATTTATTTTGTTGGCGT
GAAGAATAATGAGCAAATCTATAATTGGGCGAAAAAACATAATATCGACCCAAATAAAGTGAATAGAAAA
TTAATTACCCTTAATCATGATAATGGAGCCTGGTTACAGTATGCAGATGGCAAAATGCCTGCTGCATTCC
AAATTCAACAGGATGGGCAATGGCAACAAATCGTCTATTAA
 Primer design