SecReT4
Protein ID: 209947548
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.33
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]29204..29962 [+]
Productputative exported protein precursor
Component typeTfc4
UniProt IDQ6A277
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 252 a.a.     [Download]
>gi|209947548|ref|YP_002291045.1| putative exported protein precursor [Haemophilus influenzae]
MATNRLLKIVFSLIGLGVATHSVAFNGFGTDIDGYIKDASNRYQVDEAMLRGLVKIEDGWYGNVSPTGAT
GVGQFTRGTWNWLATTDEGRALGMTQITRYNRDTPFDPRKNNQLNTLATALLARWHINQFFERGIKPSHE
NLYLAHNIGIDGLHRALQGRATREDILNMKRNGMKKGMSVQGFLVYQSERFNVSKQIANFQRPSVSPRYQ
IENKPLPANLHWVSPTETAMRWVEPASNQTNQQAIRWQNPTN
 
Nucleotide Sequence: 759 bp     [Download]
>gi|209947517|ref|NC_011409.1|:29204-29962 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGGCAACAAATCGTCTATTAAAAATCGTATTTAGCTTAATCGGTCTTGGAGTTGCGACTCACTCCGTTG
CATTTAATGGCTTTGGAACTGATATTGATGGCTATATTAAAGATGCATCTAATCGCTACCAGGTCGATGA
AGCGATGCTACGTGGGTTAGTAAAAATTGAAGATGGGTGGTATGGAAATGTTTCCCCAACCGGGGCAACC
GGTGTGGGGCAATTTACCCGGGGTACCTGGAATTGGCTTGCCACAACAGATGAGGGGCGAGCCTTAGGTA
TGACTCAAATCACTCGTTACAATCGTGATACACCTTTCGACCCTAGAAAAAACAATCAACTTAACACTCT
AGCAACCGCACTTTTAGCTAGATGGCATATTAATCAGTTTTTTGAGCGAGGCATAAAACCATCCCATGAA
AATTTATATCTTGCTCATAATATCGGTATAGATGGGTTACATCGAGCGCTACAAGGTAGAGCAACACGTG
AAGATATTCTAAATATGAAACGTAACGGGATGAAAAAAGGAATGTCGGTACAAGGCTTTCTTGTTTATCA
AAGTGAGCGTTTTAATGTCAGTAAACAAATAGCTAACTTCCAGCGCCCTTCAGTATCACCACGTTATCAA
ATTGAGAACAAACCATTACCAGCCAATTTACATTGGGTTTCTCCAACAGAAACCGCTATGCGTTGGGTTG
AGCCAGCGTCAAATCAAACAAATCAACAAGCTATTCGTTGGCAAAATCCAACCAATTAA
 Primer design