SecReT4
Protein ID: 209947549
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.34
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]29978..30484 [+]
Productputative exported protein precursor
Component typeTfc5
UniProt IDQ6A276
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.2e-48, Aligned region: 26..166
Protein Sequence: 168 a.a.     [Download]
>gi|209947549|ref|YP_002291046.1| putative exported protein precursor [Haemophilus influenzae]
MQYKSFFLSLVCLGAVVQAQAELKVIGDFGGESAVRFYEALQPDESMVQAYPNSVPSTLTEADILPVISH
RMTPGQIQPVRMNLPGMLPIFLIGTDNLSKNWLHANYNYLKKIGAMGLVVSVKTTNELSELRQLAPDLTL
MPTPGDDLASRLNLAHYPALLTSEGLSQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|209947517|ref|NC_011409.1|:29978-30484 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGCAGTATAAATCCTTTTTCCTCTCTTTGGTCTGCTTAGGAGCAGTAGTTCAGGCGCAAGCTGAATTAA
AAGTTATTGGTGATTTTGGCGGAGAAAGTGCAGTCCGTTTTTATGAAGCATTACAACCGGATGAATCAAT
GGTTCAAGCCTACCCTAATAGCGTTCCTTCAACATTGACCGAAGCGGATATTTTACCTGTTATCTCACAT
AGAATGACACCGGGCCAAATACAACCAGTCAGAATGAATCTTCCTGGAATGTTGCCTATTTTTCTTATTG
GAACAGATAACTTATCTAAAAATTGGCTACACGCTAATTATAATTACCTTAAAAAAATTGGTGCAATGGG
ACTTGTAGTAAGCGTTAAAACAACAAACGAATTAAGCGAGTTACGCCAATTAGCACCTGATTTAACCTTA
ATGCCAACGCCAGGGGATGACTTAGCTTCAAGATTGAATCTTGCTCACTACCCTGCTTTATTGACTTCAG
AAGGATTGTCGCAATGA
 Primer design