SecReT4
Protein ID: 209947552
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.37
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]33049..33735 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ6A273
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 6.6e-66, Aligned region: 38..225
Protein Sequence: 228 a.a.     [Download]
>gi|209947552|ref|YP_002291049.1| hypothetical protein p1056.37 [Haemophilus influenzae]
MAEQQVKKKKKGLFYYINAVLAALFGSLILSIILEWLGIAFLWPEEGHLHSQKMMLTELGWLSDSLTRGL
FYHSPKELAEGLILSLHEWLFVKTGVKDWLANPREHSGVGLWVYHYGRAYIESVIYVFITFVIRLVVIVF
TSPLFLLAAFAGFTEGLMMRDRRKFGAGRESSFLYHHARRLIGPIMLSAWVLYLSIPISIYPNIILVPAA
FLFGLSICVTAASFKKYL
 
Nucleotide Sequence: 687 bp     [Download]
>gi|209947517|ref|NC_011409.1|:33049-33735 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGGCAGAACAACAAGTCAAAAAAAAGAAAAAGGGTCTTTTTTACTACATTAATGCGGTATTAGCCGCCT
TATTTGGTTCCCTGATTTTGAGCATTATTCTTGAATGGTTAGGTATTGCATTTTTATGGCCTGAAGAAGG
TCATTTACACAGTCAAAAAATGATGCTAACTGAGCTTGGATGGCTTTCTGATAGTCTAACGAGAGGTCTT
TTCTATCATTCTCCAAAAGAGCTGGCTGAAGGTCTTATTTTGTCATTACATGAATGGCTTTTTGTGAAAA
CAGGTGTAAAAGATTGGTTAGCCAACCCTCGTGAGCATAGTGGCGTAGGTTTGTGGGTGTATCATTATGG
GCGAGCTTATATTGAGTCAGTGATTTATGTTTTTATCACCTTTGTTATTCGACTTGTAGTGATTGTTTTT
ACGTCCCCACTCTTTTTGTTAGCCGCATTTGCGGGCTTTACTGAAGGATTAATGATGCGTGACCGTCGTA
AATTTGGTGCGGGCAGAGAGTCTAGTTTTCTTTATCATCATGCACGTCGATTAATTGGCCCGATTATGTT
GTCGGCATGGGTATTGTATCTTTCTATCCCAATTTCTATTTACCCGAATATAATTTTGGTGCCAGCTGCA
TTTCTATTTGGACTATCCATCTGTGTAACGGCAGCGAGCTTTAAAAAATACCTTTAA
 Primer design