SecReT4
Protein ID: 209947553
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.38
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]33866..34216 [+]
ProductPutative exported protein precursor
Component typeTfc9
UniProt IDQ6A272
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3e-29, Aligned region: 28..110
Protein Sequence: 116 a.a.     [Download]
>gi|209947553|ref|YP_002291050.1| Putative exported protein precursor [Haemophilus influenzae]
MESVSSKEFSVTKNIFSLSLAIGLLFGAISAQATEQEHLAQAIKQLDAAKLSLQRAAASAKVSAKSREYF
DYASAHQDITTVQAGIKQYINPSRAIPRNPKAIRNLKEDYLNLRSQ
 
Nucleotide Sequence: 351 bp     [Download]
>gi|209947517|ref|NC_011409.1|:33866-34216 Haemophilus influenzae plasmid ICEhin1056, complete sequence
TTGGAATCTGTTTCAAGTAAGGAGTTCTCCGTGACTAAAAATATTTTCAGTTTATCTCTAGCAATAGGGT
TATTGTTTGGCGCTATAAGTGCTCAAGCAACAGAGCAAGAGCATTTAGCGCAAGCAATTAAACAGTTGGA
TGCAGCAAAACTCTCATTACAGCGAGCAGCTGCAAGTGCAAAGGTTTCTGCGAAAAGTCGAGAATATTTT
GATTACGCTTCAGCGCATCAAGATATTACTACTGTGCAGGCAGGGATTAAACAATATATTAACCCTTCCC
GGGCTATTCCTAGAAATCCTAAAGCTATTCGTAACTTAAAAGAAGATTATCTTAATCTTCGGAGTCAATA
G
 Primer design