SecReT4
Protein ID: 209947555
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.40
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]34906..35277 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ6A270
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.1e-39, Aligned region: 6..121
Protein Sequence: 123 a.a.     [Download]
>gi|209947555|ref|YP_002291052.1| hypothetical protein p1056.40 [Haemophilus influenzae]
MSSDKEQTIPFLPTRLNRESSVYGGLSVSEFMLAAAMGFILGAVLGLLCCFALGFDFWLLIPSLAMLFCI
LSVVIGKVIIARLKRGKPKAYLNRMIEVKLDGILGGNRFISRQGTWSIRRVKK
 
Nucleotide Sequence: 372 bp     [Download]
>gi|209947517|ref|NC_011409.1|:34906-35277 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGTCAAGTGATAAAGAGCAAACGATCCCCTTTCTTCCTACTCGATTAAATCGTGAATCGAGTGTGTATG
GCGGGTTATCTGTAAGTGAATTTATGTTGGCTGCAGCAATGGGATTTATCTTAGGTGCAGTGCTTGGCCT
CCTTTGTTGTTTTGCCTTAGGCTTTGATTTTTGGTTGTTAATTCCGTCTCTCGCCATGTTGTTTTGCATT
CTTTCTGTGGTGATTGGCAAAGTGATTATTGCGCGCCTTAAACGAGGTAAGCCGAAAGCCTACTTGAATC
GAATGATTGAGGTTAAATTAGATGGAATATTAGGGGGGAATCGCTTTATCTCCCGTCAAGGCACTTGGTC
TATTCGCCGAGTTAAAAAATAA
 Primer design