SecReT4
Protein ID: 209947562
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.47
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]41945..42268 [+]
Producthypothetical membrane protein
Component typeTfc18
UniProt IDQ6A263
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 107 a.a.     [Download]
>gi|209947562|ref|YP_002291059.1| hypothetical membrane protein [Haemophilus influenzae]
MSQGKKPQSRGWLKNVLRFIAILLFLFLALTAIGIFATQYLQNVDIRAWFIKTQWIWFAVRLLLYGAIML
MVYSISRRQPSSMPAKAKWLIAMILIFAEAITQITLA
 
Nucleotide Sequence: 324 bp     [Download]
>gi|209947517|ref|NC_011409.1|:41945-42268 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGTCTCAAGGTAAAAAGCCACAATCAAGAGGATGGCTTAAAAATGTACTCCGTTTTATTGCTATCCTTT
TATTTTTATTTTTAGCCCTTACTGCAATTGGCATCTTTGCAACTCAATATCTTCAGAATGTTGATATTCG
TGCTTGGTTTATTAAAACGCAGTGGATATGGTTTGCAGTACGATTATTACTATATGGTGCGATTATGTTG
ATGGTCTATTCCATTTCTCGTCGCCAACCATCTTCTATGCCGGCAAAAGCAAAATGGTTAATTGCGATGA
TTTTAATTTTTGCTGAAGCGATTACACAGATTACTTTAGCTTAG
 Primer design