SecReT4
Protein ID: 209947563
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.48
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]42277..43770 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDQ6A262
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.8e-112, Aligned region: 10..484
Protein Sequence: 497 a.a.     [Download]
>gi|209947563|ref|YP_002291060.1| hypothetical protein p1056.48 [Haemophilus influenzae]
MTFSVDSYLEYFLTLLGWLLNNGVFALFVGTGLWLLPLIGMIFKIWRDVAKQGDDEGEKGDLLIRWLTIE
LLPAMLIVVLTLAPLIPVSLNNLEYNERSSIQCGYKVPASPDKSGYAPFTTTFGDRQARIPIWWMLMHKV
DKGLTYGMTAVLPCQRDLRQVRFEVQHQKITNPALLTEVQQFVQQCYIPARQKLQTSQLALSPAQIRETS
WLGGKLLINNSELYPRFRAQQPISTFPYDANRDAALPNSGKGGFPSCDQWWDESGAGLKSRLLTDMRQNL
SAQVSDFFNSIDNQDEALLRTLLRSENIDVSKGKMYQGYGGSVDAGFWNAVTRLTSTVGTAVGSLAIFPG
LDAMRQALPMVQAFMIMAVIILIPIITILSGFAIKTVMTLSFVYFALITTTFWWELARWLDSYLIEIMYS
SPSHNMLNIHFLENAEDDIISNFVMGSLFIILPGLWFGAMTWAGIRVGGELSAAIAKGTESSQKSGGQFG
DKISKKI
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|209947517|ref|NC_011409.1|:42277-43770 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGACATTCTCAGTTGACAGTTATCTTGAATATTTCCTGACTCTACTTGGTTGGTTGCTTAATAACGGAG
TTTTTGCGTTATTTGTTGGAACAGGGTTATGGCTTCTTCCGCTTATCGGAATGATCTTTAAAATTTGGCG
TGACGTAGCTAAACAAGGGGATGATGAAGGTGAGAAAGGGGATTTATTAATCCGCTGGCTCACAATCGAA
CTCCTTCCAGCAATGCTTATCGTTGTTTTGACATTAGCCCCTCTTATCCCGGTATCATTGAATAACCTTG
AATACAATGAACGTTCATCTATTCAATGTGGCTATAAAGTTCCTGCTTCCCCGGATAAATCAGGCTATGC
GCCATTTACGACAACATTTGGAGACAGACAAGCCCGAATTCCTATTTGGTGGATGTTGATGCACAAAGTG
GATAAAGGTCTAACTTATGGTATGACTGCAGTATTGCCTTGCCAGCGTGATTTACGTCAGGTTAGATTTG
AAGTGCAACATCAAAAAATCACTAACCCAGCATTATTAACTGAAGTGCAGCAATTTGTGCAACAATGCTA
TATCCCGGCTCGTCAAAAATTACAAACAAGCCAACTTGCCTTGAGTCCGGCACAAATCCGCGAAACATCC
TGGTTAGGTGGTAAATTGCTTATTAATAACAGCGAGCTCTACCCTCGTTTTAGGGCTCAGCAACCTATTA
GCACGTTCCCTTATGATGCAAATCGAGATGCGGCATTACCTAATTCGGGAAAAGGTGGTTTCCCAAGTTG
TGATCAATGGTGGGATGAAAGTGGAGCTGGATTAAAATCTCGCTTACTTACAGATATGCGTCAAAACTTA
TCTGCCCAGGTGAGTGATTTCTTTAACTCTATCGACAACCAAGATGAAGCTTTATTGAGAACACTTTTAC
GCTCTGAAAACATAGATGTTTCAAAAGGGAAAATGTATCAAGGTTACGGTGGTAGCGTGGATGCTGGATT
TTGGAATGCGGTTACTCGACTCACCTCAACTGTAGGAACGGCTGTTGGAAGTTTGGCTATATTCCCAGGC
CTAGATGCAATGCGACAAGCCCTACCAATGGTTCAAGCCTTTATGATTATGGCTGTAATTATTTTAATTC
CAATTATTACGATTTTAAGTGGCTTTGCTATTAAAACTGTAATGACATTAAGCTTCGTATATTTTGCACT
CATTACAACCACATTTTGGTGGGAGTTAGCAAGATGGCTTGATTCATACCTAATAGAAATTATGTATAGT
TCTCCATCTCATAATATGCTAAACATCCACTTTTTAGAAAATGCAGAAGATGACATTATTTCTAACTTTG
TGATGGGGAGTTTATTTATAATTTTACCTGGTTTATGGTTTGGAGCAATGACCTGGGCTGGAATTCGAGT
GGGTGGCGAGCTTAGCGCTGCCATTGCGAAAGGAACTGAATCATCCCAAAAATCAGGGGGGCAATTTGGA
GATAAAATTAGTAAAAAAATATAA
 Primer design