SecReT4
Protein ID: 209947564
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.49c
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]43826..44155 [-]
Producthypothetical membrane protein
Component typeTfc20
UniProt IDQ6A261
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 109 a.a.     [Download]
>gi|209947564|ref|YP_002291061.1| hypothetical membrane protein [Haemophilus influenzae]
MDAQKFGHTVGQFFKKIDRTLSFLPGKPRKAVVTAAALAASPILAGVIISKTKPSKNIEYLDEEPVSDTS
LLSELLANDDSSEEGKWDYGFQGFGYYINGVKVYGDDDD
 
Nucleotide Sequence: 330 bp     [Download]
>gi|209947517|ref|NC_011409.1|:c44155-43826 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGGACGCTCAAAAGTTTGGCCATACTGTCGGACAATTTTTTAAGAAAATTGACCGCACTTTGTCATTTC
TCCCAGGAAAGCCTCGTAAAGCTGTTGTGACAGCTGCTGCTCTTGCTGCGAGTCCAATTTTGGCCGGAGT
TATAATTTCCAAAACCAAGCCTTCTAAAAACATTGAATATTTAGATGAAGAGCCAGTAAGTGATACATCT
TTGTTGTCAGAATTACTTGCAAATGATGATTCATCAGAAGAAGGAAAGTGGGATTATGGTTTTCAGGGGT
TTGGCTATTATATTAACGGAGTAAAAGTTTACGGAGATGATGACGATTAA
 Primer design