SecReT4
Protein ID: 209947565
T4SS name [ID]Tfc [45]
Gene symbol-
Locus tagp1056.50c
StrainHaemophilus influenzae plasmid ICEhin1056 (NC_011409)
Repliconplasmid ICEhin1056 [GenBank: NC_011409] [Browse all T4SS(s) in this replicon]
Location [Strand]44575..44982 [-]
Producthypothetical protein
Component typeTfc21
UniProt IDQ6A260
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|209947565|ref|YP_002291062.1| hypothetical protein p1056.50c [Haemophilus influenzae]
MKKLLTIGAVAMFATPAFAANNIFSCTAENGSPVSVTKNGSDYEFTYGQVSFKNPVKQVFANQDSYVATG
SGFITSSLEMRNNGTSYTIQFVQPHNSNSIEEPMLYITNGSKMDTVSCKAGSATQNFERRSMKAS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|209947517|ref|NC_011409.1|:c44982-44575 Haemophilus influenzae plasmid ICEhin1056, complete sequence
ATGAAAAAATTACTCACTATTGGAGCGGTAGCTATGTTTGCAACGCCAGCTTTTGCAGCTAATAATATTT
TTTCTTGTACAGCAGAGAACGGAAGCCCGGTGTCTGTAACAAAAAATGGTTCAGATTATGAATTCACTTA
TGGCCAGGTTTCTTTTAAAAATCCGGTAAAACAAGTTTTTGCTAATCAGGATTCTTATGTAGCTACTGGT
TCAGGATTTATTACTAGCTCATTAGAAATGAGAAATAATGGCACAAGTTACACGATTCAATTTGTGCAAC
CACACAATAGTAACAGTATTGAAGAGCCAATGCTTTATATCACCAATGGCAGTAAAATGGATACGGTGAG
CTGTAAAGCGGGTAGTGCAACTCAAAACTTTGAACGTCGCAGTATGAAAGCTTCATAA
 Primer design