SecReT4
Protein ID: 210134651
T4SS name [ID]VirB [607]
Gene symbolvirD4-1
Locus tagHPP12_0454
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]476105..477832 [-]
ProductVirD4 coupling protein
Component typeVirD4
UniProt IDB6JL32
KEGG IDhpp:HPP12_0454
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.7e-68, Aligned region: 83..563
TrwB_AAD_bind [PF10412], Evalue: 9.1e-29, Aligned region: 323..542
TraG-D_C [PF12696], Evalue: 3e-23, Aligned region: 411..531
AAA_10 [PF12846], Evalue: 8.2e-10, Aligned region: 82..487
Protein Sequence: 575 a.a.     [Download]
>gi|210134651|ref|YP_002301090.1| VirD4 coupling protein [Helicobacter pylori P12]
MREKFKTLRDKFKDKTSNLFHKLNSIQKDYYTKTLPKACKDVFTLGSSKSYPMTLNFNKGFCVGLYKGLN
SLKPTYYDAPLSTLIIAPPGSGKTAAVAVPNLLSVPSSCVVLDIKGELFDLTAGYRQQVLKNKIFVFDPL
GNDNTLKFNPFDKRIVEKLDFNRKRRLVDEVGNTIFAEDGANKDPHWTQQAKNLFVFYALYDLCVHNTST
FFEIASAPIKNYVPLINPQSRFYTELYECQSSDNGFVKENGRYMAKVENGVKKMKPNANVELLWYKQVAE
QVYTDPENPKNYDGSVNHLEKDDQGNVIMKEGMLDPIIRNEANKWAKANDKEFASIKSVYSRFMQVFTSY
QVKSATDSMSFEYEDLRADNISLYIKIAQTDIDTLAPLIRILLESIAKNLLLKESKKFEERVYLFLDEFV
RFGKLPFLLEMPALSRSYGVVLIFITQPNALIEKYYGREDARIVNSTVAYKIIFKMDDLEYAKQVSEEVG
KMTRKTRSHSTEKGQLITGGTSSIGKEAWDLLSAQDIMNIDKDEVIVLVSGHKAKPLKLKANYYFKNKEL
LSRINWEVKPNEEVF
 
Nucleotide Sequence: 1728 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c477832-476105 Helicobacter pylori P12 chromosome, complete genome
ATGAGAGAAAAATTCAAAACATTAAGAGATAAATTTAAGGATAAAACCAGCAATTTATTCCATAAGCTTA
ATAGCATTCAAAAAGATTATTACACTAAAACTCTCCCTAAGGCTTGCAAAGATGTCTTTACGCTAGGTTC
TTCTAAGAGTTATCCTATGACCTTAAATTTTAACAAAGGTTTTTGTGTGGGGCTGTATAAAGGTTTAAAT
TCGCTTAAGCCTACTTATTATGATGCTCCGCTTTCTACTTTAATTATCGCTCCTCCTGGAAGTGGTAAAA
CCGCAGCTGTGGCTGTGCCTAATCTTTTAAGTGTGCCTAGCTCTTGTGTGGTGTTAGATATTAAAGGGGA
GTTGTTTGATTTAACGGCTGGTTACAGACAACAAGTTCTAAAAAATAAAATTTTTGTATTTGATCCTTTA
GGAAATGATAACACGCTTAAATTCAATCCGTTTGATAAACGCATTGTAGAAAAATTAGATTTTAACAGAA
AGCGAAGGCTTGTAGATGAAGTGGGTAATACTATTTTTGCTGAAGATGGGGCAAATAAAGACCCTCATTG
GACACAGCAAGCTAAAAATTTATTTGTCTTTTACGCTCTTTATGATTTGTGTGTGCATAACACTAGCACC
TTTTTTGAAATTGCAAGCGCTCCTATAAAAAATTATGTCCCCTTAATCAATCCACAAAGCCGATTTTATA
CTGAATTATATGAATGCCAAAGTAGCGATAATGGTTTTGTTAAAGAGAATGGGCGTTATATGGCTAAAGT
AGAAAATGGCGTTAAAAAAATGAAACCTAATGCCAATGTGGAATTGCTATGGTATAAACAAGTAGCCGAA
CAAGTCTATACTGACCCAGAAAATCCTAAAAATTATGATGGATCTGTGAATCATTTAGAAAAAGACGATC
AAGGCAATGTTATAATGAAAGAGGGTATGTTAGATCCTATTATTAGAAACGAAGCGAACAAATGGGCTAA
GGCGAATGATAAAGAGTTTGCGAGCATTAAATCAGTTTATAGCCGTTTTATGCAAGTCTTTACAAGCTAT
CAAGTTAAAAGCGCTACAGATAGCATGAGTTTTGAATACGAGGATTTAAGGGCTGACAATATTTCACTCT
ATATTAAAATCGCTCAAACAGATATTGACACACTCGCACCGCTTATCCGTATCCTTTTGGAAAGTATTGC
TAAAAATCTTTTATTGAAAGAGAGTAAGAAATTTGAAGAAAGGGTTTATCTCTTTTTAGATGAATTTGTG
CGTTTTGGTAAATTGCCTTTTTTATTAGAAATGCCAGCATTAAGTAGGAGCTATGGTGTGGTTTTAATTT
TTATCACGCAACCCAACGCTCTTATTGAAAAATATTATGGCAGAGAAGATGCAAGAATTGTTAATAGCAC
CGTGGCTTACAAAATAATTTTCAAAATGGATGATTTAGAATATGCTAAACAAGTGAGCGAAGAAGTCGGT
AAGATGACTAGAAAAACACGAAGCCACTCTACAGAAAAAGGACAACTCATTACCGGAGGGACTTCTAGCA
TAGGTAAAGAGGCGTGGGACTTATTGAGCGCGCAAGATATTATGAATATTGATAAAGATGAAGTGATCGT
TTTAGTAAGCGGTCATAAGGCTAAACCCTTAAAATTAAAAGCGAATTATTATTTCAAAAACAAAGAATTA
CTCTCTCGTATTAACTGGGAAGTCAAGCCCAATGAAGAAGTGTTTTGA
 Primer design