SecReT4
Protein ID: 210134655
T4SS name [ID]VirB [607]
Gene symbolvirB11-1
Locus tagHPP12_0458
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]479131..480072 [-]
ProductVirB11 type IV secretion ATPase
Component typeVirB11
UniProt IDB6JL36
KEGG IDhpp:HPP12_0458
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.1e-49, Aligned region: 14..290
Protein Sequence: 313 a.a.     [Download]
>gi|210134655|ref|YP_002301094.1| VirB11 type IV secretion ATPase [Helicobacter pylori P12]
MISNLLKSYLDDFMPILSQPNLNEVVFNKEKEYFLHRPKEKVRCFNEKFTNDYLLVFCEQLAIFRNQKFT
LKTPKLNTSLPYTQIRINALHPSIIASSNISINIRVPSNFKFEINAFKLSEKCLAKNITYDFLLSLVSAG
KNILISGGTASGKTSFVNSLIENIPKNERVVTIEDSPELKISNEDQVNILVDKSGSGFFTYEDGLNAAMR
MSPDRLLLGEIDTHNTALFLRLANTGHSGMISTLHANSVVDAFIAICQNINLNKGGKPTPKETLLDYFCT
GMDYVIQIKKKGSDRIIDDVLNVKSEFKKELML
 
Nucleotide Sequence: 942 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c480072-479131 Helicobacter pylori P12 chromosome, complete genome
ATGATTTCTAATCTTTTAAAAAGTTACCTTGATGACTTTATGCCTATTTTAAGTCAGCCTAATTTAAATG
AAGTGGTTTTTAATAAAGAAAAAGAGTATTTCTTGCACCGCCCAAAGGAAAAAGTGAGGTGTTTTAATGA
AAAATTTACTAATGATTATTTGTTAGTTTTTTGTGAGCAATTAGCCATTTTTAGAAACCAAAAATTCACT
CTAAAAACGCCTAAGTTAAACACTTCTTTGCCTTACACACAAATTAGAATTAACGCATTACACCCTAGCA
TTATTGCTAGTTCTAATATTTCTATCAATATCAGAGTGCCTAGCAATTTCAAGTTTGAAATTAACGCCTT
TAAATTAAGTGAGAAATGTCTGGCTAAAAACATTACCTATGATTTTTTACTTAGCTTAGTAAGTGCAGGT
AAAAATATTTTAATCAGTGGTGGCACAGCTAGTGGTAAGACTAGCTTTGTTAATTCTTTGATTGAAAATA
TTCCCAAAAACGAAAGAGTAGTTACTATTGAAGATAGTCCTGAGTTGAAAATCAGTAACGAAGACCAAGT
TAATATTTTAGTAGATAAAAGTGGGAGCGGATTTTTTACTTATGAAGATGGCTTAAATGCGGCTATGAGA
ATGTCTCCTGATAGATTATTATTAGGCGAAATTGACACGCATAATACTGCGTTATTTTTGCGTTTAGCAA
ATACTGGGCATAGCGGAATGATAAGCACCTTACATGCTAATAGTGTAGTAGATGCTTTTATAGCTATTTG
TCAGAATATCAACTTGAATAAAGGCGGTAAGCCTACGCCTAAAGAAACGCTTTTAGATTATTTTTGCACT
GGTATGGACTATGTTATCCAAATCAAAAAAAAAGGTAGCGATAGGATAATTGATGATGTTTTAAATGTTA
AAAGCGAATTTAAAAAGGAGTTGATGTTATGA
 Primer design