SecReT4
Protein ID: 210134659
T4SS name [ID]VirB [607]
Gene symbolvirB10-1
Locus tagHPP12_0462
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]480987..482252 [-]
ProductVirB10 type IV secretion protein
Component typeVirB10
UniProt IDB6JL40
KEGG IDhpp:HPP12_0462
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-45, Aligned region: 202..397
Protein Sequence: 421 a.a.     [Download]
>gi|210134659|ref|YP_002301098.1| VirB10 type IV secretion protein [Helicobacter pylori P12]
MGFFRVIRNAPIVSVFIVLMLIFCAWFFLYDDSSPKAVKIYVKGKFPISDYLYKQADEKKILPQNNVVKQ
EIKEERIKKSCKGQITDSKGNLIDDDCNIIATQKQVNNLPNLPKDILKTKPTVTSNPSNYNTANEEEKTR
LVILASRISSQKETQPPTSIKNSVSHTKSKEKQGLEKEYGSSGFKNFKRKNIASSENKLLRMITADRMIP
AILITPISSEIGGSKVVAQVESDIYATMGRAVLIPKGSRAIGYYNSNNKIGEYRLEIAWNRIITPQGVNI
ILSDAKGADVKGYNGMIGTLHNKYWERYGIPLSLSTLSNGLLIGLTSGLTEAMKNKKGGFNQNYFGDYMM
MQMTRQTGISLNNIIAQIMREQIRIKPIITIREGSHIFISPNTDIWFPIPKNNEVLAKFFNEEKEQNNDT
K
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c482252-480987 Helicobacter pylori P12 chromosome, complete genome
ATGGGCTTTTTTAGAGTAATTAGAAACGCACCGATTGTAAGTGTCTTTATTGTTTTGATGCTTATTTTTT
GTGCATGGTTTTTCCTTTATGATGATAGCTCGCCTAAAGCAGTAAAAATATATGTTAAAGGTAAGTTTCC
AATCTCTGACTATCTCTACAAACAAGCGGATGAAAAGAAAATCCTACCACAGAACAATGTCGTTAAACAA
GAAATTAAAGAAGAAAGAATTAAAAAATCTTGTAAGGGTCAGATAACAGATAGTAAGGGTAATTTAATAG
ATGATGATTGCAATATTATAGCCACTCAAAAACAAGTTAATAATTTACCAAACTTACCAAAAGATATACT
TAAAACCAAACCTACTGTTACCTCCAATCCTTCCAACTACAATACCGCTAACGAAGAAGAAAAAACCCGC
CTGGTGATTTTAGCGTCTCGTATTAGCAGCCAAAAAGAAACGCAGCCTCCAACCTCTATAAAAAATAGTG
TTTCTCACACAAAATCCAAAGAAAAACAAGGACTTGAAAAAGAATACGGCTCTAGCGGTTTTAAAAATTT
TAAAAGAAAAAATATAGCGAGCAGTGAAAACAAACTTTTGAGAATGATTACAGCTGACAGGATGATCCCA
GCCATTCTGATCACTCCTATTAGCAGTGAAATAGGGGGGAGTAAGGTAGTCGCTCAAGTGGAGAGTGATA
TATACGCAACGATGGGTAGAGCGGTTTTAATCCCCAAAGGGAGTAGAGCCATAGGCTATTACAACTCTAA
TAACAAAATAGGAGAATACCGCTTAGAAATTGCTTGGAATAGGATAATCACGCCACAAGGGGTCAATATC
ATACTAAGCGATGCTAAAGGGGCTGATGTCAAGGGCTATAACGGCATGATAGGCACACTCCATAACAAAT
ATTGGGAACGCTATGGTATTCCTTTATCCTTAAGCACCTTGTCAAATGGGCTACTCATAGGTCTTACTAG
CGGTCTTACCGAAGCGATGAAAAACAAAAAGGGTGGTTTTAATCAAAACTATTTTGGAGATTACATGATG
ATGCAAATGACGAGGCAAACTGGTATCAGCCTAAATAATATTATCGCTCAAATCATGCGAGAGCAAATCA
GGATTAAGCCCATTATCACTATTAGAGAAGGAAGCCATATTTTTATTAGTCCTAATACGGATATTTGGTT
TCCTATCCCTAAAAACAATGAAGTCTTAGCGAAATTTTTTAATGAAGAAAAGGAGCAAAACAATGATACA
AAATAG
 Primer design