SecReT4
Protein ID: 210134660
T4SS name [ID]VirB [607]
Gene symbolvirB9-1
Locus tagHPP12_0463
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]482252..483784 [-]
ProductVirB9 type IV secretion protein
Component typeVirB9
UniProt IDB6JL41
KEGG IDhpp:HPP12_0463
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.6e-29, Aligned region: 91..244
CagX [PF03524], Evalue: 1.6e-29, Aligned region: 286..367
Protein Sequence: 510 a.a.     [Download]
>gi|210134660|ref|YP_002301099.1| VirB9 type IV secretion protein [Helicobacter pylori P12]
MKKFTLSLFLYCALLSAEEDIFRNNTNETDLTNSFEHGKENNNLIPAKSDSLESFKEQENKEKAKQLMDL
KALQSVYFSKNRKLQDNNFNVLYVAGNTNKIRLRYAMTTTFIFDNDPIIYVSLGDPSGFELTYPTNDHYD
LSNMLVIKPLLIGVDTNLTVVGASGTIYTFYLFSTTYTSKFQSYFSVFVSNKRSIGKLNILSKNELEKRE
QEQWAKTETNTNSSNKQDKHKLDYRKINYESKEIDDGKFIRIGDEVNHIFIEKAKINRGYLQKPKHKRTW
WSLWLYKKPSDDALDIKALDVFDDGKYTYFRYDRDQAFSKFPYTYKVVDGYDNPINSRVVGNYIIAEDVS
KKWTLRSGKEYVCVRRDKHKYQKSKDFMRLKRLLEQDEAMKAKRNNIHLIEDTTPQPKNAISVTELLAQI
KNQTPNEKCRALNEEEVKTLEEVKNIIKAPKPLQKDLKNKLKKHTIKTHYCVPIPYIERPKTTDGLEKNK
KGLNNTQKQNQANPVKEIKK
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c483784-482252 Helicobacter pylori P12 chromosome, complete genome
ATGAAAAAATTCACTCTATCGCTATTTTTGTATTGCGCTTTACTTAGTGCTGAAGAGGATATTTTTAGGA
ACAACACAAATGAAACTGATCTTACAAATTCTTTTGAACATGGCAAAGAAAACAACAATCTTATCCCAGC
AAAATCTGATAGTTTAGAAAGTTTCAAAGAACAAGAAAACAAAGAAAAAGCCAAACAGCTTATGGATTTA
AAAGCCTTACAGAGCGTGTATTTTTCTAAAAATAGAAAATTGCAAGACAATAATTTCAATGTCTTGTATG
TGGCAGGCAACACCAACAAAATCCGCTTACGCTATGCGATGACTACCACTTTTATTTTTGATAATGATCC
TATTATCTATGTGAGCTTAGGAGATCCTAGCGGATTTGAGCTCACTTACCCCACTAATGATCATTACGAT
TTGTCCAACATGCTAGTGATCAAACCCTTGCTTATAGGGGTGGATACAAACCTAACCGTAGTCGGAGCGA
GCGGCACAATTTATACCTTTTATTTGTTTAGCACCACTTACACCAGCAAGTTTCAAAGCTATTTTTCAGT
GTTTGTCTCTAATAAAAGATCTATCGGTAAGCTCAATATTTTATCTAAAAACGAGCTAGAAAAAAGAGAG
CAAGAACAATGGGCTAAAACAGAAACAAATACAAATAGCTCTAATAAACAAGATAAGCATAAGCTTGACT
ACAGAAAAATCAATTATGAGAGCAAGGAAATTGATGATGGCAAGTTTATAAGAATTGGAGATGAAGTCAA
TCACATTTTCATTGAAAAAGCTAAAATCAATCGTGGTTATTTGCAAAAACCCAAACACAAACGCACCTGG
TGGAGTTTGTGGCTCTATAAAAAACCCAGCGATGACGCGCTTGATATAAAGGCGCTAGATGTCTTTGATG
ATGGCAAATACACTTATTTTAGATATGACAGGGATCAAGCCTTTTCAAAATTTCCTTATACCTATAAGGT
TGTAGATGGGTATGATAATCCTATCAATAGCCGTGTGGTAGGGAATTACATTATTGCTGAAGACGTTTCT
AAAAAATGGACTTTAAGGAGCGGTAAGGAATACGTGTGCGTGAGAAGAGACAAGCACAAATACCAAAAGT
CTAAGGACTTCATGCGTTTAAAAAGGCTTTTAGAGCAAGATGAAGCCATGAAAGCCAAACGAAACAACAT
CCACTTGATTGAAGACACTACGCCTCAACCTAAAAATGCCATTAGCGTAACGGAGTTGTTAGCTCAAATC
AAAAACCAAACTCCAAATGAAAAATGCCGAGCCTTAAATGAAGAAGAAGTTAAGACTTTAGAAGAGGTTA
AAAACATCATAAAAGCTCCCAAGCCTTTGCAAAAAGATTTGAAAAACAAGCTCAAAAAACACACAATCAA
AACCCACTATTGCGTGCCTATCCCCTATATAGAAAGACCAAAAACCACTGATGGTTTAGAGAAGAATAAA
AAGGGGCTGAATAACACCCAAAAACAAAATCAAGCGAACCCTGTTAAAGAGATTAAAAAATAA
 Primer design