SecReT4
Protein ID: 210134661
T4SS name [ID]VirB [607]
Gene symbolvirB8-1
Locus tagHPP12_0464
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]483784..484953 [-]
ProductVirB8 type IV secretion protein
Component typeVirB8
UniProt IDB6JL42
KEGG IDhpp:HPP12_0464
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-24, Aligned region: 164..348
Protein Sequence: 389 a.a.     [Download]
>gi|210134661|ref|YP_002301100.1| VirB8 type IV secretion protein [Helicobacter pylori P12]
MSKRSEVLEQFHGGLKNLELQTKRRMDLWGDLKENEEQTLLLGEIENELKQLENKENLKADNNTEFKEEN
QDTKENQPNDLFSLPLPTQTTINGIKEFVEEPMMETEEKETPQNEPIQEKKERIFKNFFSRIGFDKSIAP
TMLFEEVRDASVIYHLEKKLGDYIFYVACFFFGTTALLIILLIVLLPLKQKVPYLVQFSNNKENFALVQK
ADSTITANKALIRSLVGAYVLNRESITHIEQHEKMRQNTIKEQSSNEVWYEFEKLIAHYDSIYTNPLLTR
KVKIANIYLDKDLAYIDIEVSLYHSGELESLKRYKVVMSFEFKKQEINFDSMSLNPTGFIVTGYDVTEIA
ILKDLDEKNKVKDDGVKSRIIHTEKKDPHMSQYKDVKEQ
 
Nucleotide Sequence: 1170 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c484953-483784 Helicobacter pylori P12 chromosome, complete genome
ATGTCAAAAAGAAGCGAAGTTTTAGAACAATTTCATGGCGGTTTAAAAAATTTAGAATTACAAACTAAAA
GACGCATGGATTTGTGGGGCGATCTAAAAGAGAATGAAGAACAAACTTTGCTTTTAGGAGAAATTGAAAA
TGAATTAAAGCAATTAGAAAACAAAGAAAATCTTAAAGCAGACAACAACACAGAATTTAAAGAAGAAAAT
CAAGACACTAAAGAAAACCAGCCTAACGATTTGTTTTCTTTGCCATTGCCCACTCAAACCACCATCAATG
GAATTAAAGAATTTGTAGAAGAGCCTATGATGGAAACAGAGGAAAAAGAAACACCCCAAAACGAGCCAAT
CCAAGAAAAAAAAGAAAGAATTTTTAAAAACTTTTTCTCCAGAATAGGCTTTGATAAAAGCATTGCCCCC
ACAATGCTTTTTGAAGAAGTGAGAGATGCAAGCGTTATCTATCATTTAGAGAAAAAATTAGGCGATTATA
TCTTTTATGTAGCGTGTTTCTTCTTTGGCACAACAGCGTTGCTTATTATCTTACTGATTGTTCTGTTGCC
CTTAAAACAAAAAGTGCCGTATTTAGTGCAATTTTCTAACAATAAAGAAAATTTTGCTTTAGTTCAAAAG
GCAGATAGCACCATTACAGCCAATAAAGCTCTTATTCGTTCATTAGTGGGAGCGTATGTGCTAAACAGGG
AAAGCATTACTCATATTGAGCAACATGAAAAAATGCGTCAAAACACCATTAAAGAGCAAAGTTCCAATGA
GGTATGGTATGAATTTGAAAAACTCATCGCTCATTATGACAGCATTTACACTAATCCTTTACTCACAAGA
AAAGTAAAGATTGCAAATATTTACTTAGATAAAGATTTAGCCTATATTGACATTGAAGTGAGCTTGTATC
ATAGTGGAGAATTAGAGAGCTTAAAGCGCTATAAAGTGGTGATGAGTTTTGAATTTAAAAAACAAGAAAT
CAATTTTGACTCCATGTCTTTAAATCCTACAGGCTTTATTGTTACAGGTTATGATGTAACTGAAATTGCG
ATTTTAAAAGACCTAGATGAAAAAAATAAAGTCAAAGATGATGGTGTGAAATCTAGGATTATCCATACCG
AAAAAAAAGACCCTCACATGAGCCAATATAAAGATGTTAAGGAACAATAA
 Primer design