SecReT4
Protein ID: 210134662
T4SS name [ID]VirB [607]
Gene symbolvirB7-1
Locus tagHPP12_0465
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]484957..485073 [-]
ProductVirB7 type IV secretion protein
Component typeVirB7
UniProt IDB6JL43
KEGG IDhpp:HPP12_0465
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 38 a.a.     [Download]
>gi|210134662|ref|YP_002301101.1| VirB7 type IV secretion protein [Helicobacter pylori P12]
MRIFLIGIILLALSGCSNKQYEVYKSPCAFFHLNQSIG
 
Nucleotide Sequence: 117 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c485073-484957 Helicobacter pylori P12 chromosome, complete genome
ATGAGAATATTTTTAATAGGAATAATTTTGTTAGCACTAAGTGGATGTTCTAACAAACAATATGAAGTGT
ATAAAAGCCCTTGTGCCTTTTTTCACTTAAATCAATCCATAGGCTAG
 Primer design