SecReT4
Protein ID: 210134663
T4SS name [ID]VirB [607]
Gene symbolvirB3-1
Locus tagHPP12_0468
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]489522..489788 [-]
ProductVirB3 type IV secretion protein
Component typeVirB3
UniProt IDB6JL44
KEGG IDhpp:HPP12_0468
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 88 a.a.     [Download]
>gi|210134663|ref|YP_002301102.1| VirB3 type IV secretion protein [Helicobacter pylori P12]
MALLIVCVESINIREISKRETFLGLNLDSWIVSFLMSAWLLSFQPLYAMGLMASCVFVFYILEFFDEDIT
AILHALFTLRTGARNYYA
 
Nucleotide Sequence: 267 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c489788-489522 Helicobacter pylori P12 chromosome, complete genome
ATGGCATTGCTTATTGTTTGTGTTGAAAGTATCAACATTAGAGAAATCAGCAAAAGAGAAACTTTTTTGG
GATTAAACTTGGATAGTTGGATTGTTAGTTTCTTAATGTCGGCATGGTTACTTTCATTCCAACCACTTTA
TGCTATGGGTTTAATGGCTAGTTGTGTGTTTGTATTCTACATTTTAGAATTTTTTGATGAAGATATAACA
GCCATTTTGCATGCACTTTTCACATTAAGAACAGGAGCTAGAAATTATTATGCTTGA
 Primer design