SecReT4
Protein ID: 210134664
T4SS name [ID]VirB [607]
Gene symbolvirB2-1
Locus tagHPP12_0469
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]489789..490091 [-]
ProductVirB2 type IV secretion protein
Component typeVirB2
UniProt IDB6JL45
KEGG IDhpp:HPP12_0469
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-05, Aligned region: 11..91
Protein Sequence: 100 a.a.     [Download]
>gi|210134664|ref|YP_002301103.1| VirB2 type IV secretion protein [Helicobacter pylori P12]
MKTKHKGIRMFKQIRRMMSLAILMPSFLLAAPDYKQKFTQILDFISNDFIKAIGSLIIVGTCIYAYKNWD
RLGEIGWKCVGIIIITAAISNAKTLSQWLF
 
Nucleotide Sequence: 303 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c490091-489789 Helicobacter pylori P12 chromosome, complete genome
ATGAAAACAAAACATAAAGGAATAAGAATGTTTAAGCAAATTCGTAGAATGATGAGTTTGGCAATATTAA
TGCCTAGTTTTTTATTGGCGGCGCCAGATTACAAACAAAAATTCACTCAAATATTGGATTTCATAAGCAA
TGACTTTATCAAAGCTATCGGTAGTCTAATCATTGTTGGGACTTGCATTTACGCCTATAAAAATTGGGAC
AGGCTTGGAGAAATTGGTTGGAAATGCGTTGGGATTATCATTATAACCGCTGCTATTTCTAATGCTAAAA
CTTTAAGTCAATGGTTATTTTAG
 Primer design