SecReT4
Protein ID: 210134724
T4SS name [ID]Cag [35]
Gene symbolcag3
Locus tagHPP12_0529
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]553525..554970 [+]
Productcag pathogenicity island protein Delta
Component typeCagdelta
UniProt IDB6JLA5
KEGG IDhpp:HPP12_0529
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|210134724|ref|YP_002301163.1| cag pathogenicity island protein Delta [Helicobacter pylori P12]
MFRKLATSVSLIGLLTSNTLCAKEISEADKVIKATKETKETKKEAKRLKKEARQRQQIPDHKKPQYASVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINENMPYAQATFLRVPKRSDPNVHTLDKGASIDENKLFEQQKRA
YFNYANDVICRPNDEVCSPLRDEMVAMPTSDSVKQKPNIIAPYSLYRLKETNNANEAQPSPYATQTAPEN
SKEKLIEELIANSQLIANEEEREKKLLAEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVE
VPISPQTSNSDETMRVVKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKSPINPNDLRSLEEEIKSYY
IKSNGLCYANGISLYAKIKNDPYKEGMLCGYESVQNLLSPLKDKLKYDKQKLQKALLKDSK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|210134201|ref|NC_011498.1|:553525-554970 Helicobacter pylori P12 chromosome, complete genome
ATGTTTAGAAAACTAGCAACCTCTGTATCGCTCATAGGCTTACTAACCTCTAACACTCTTTGTGCTAAAG
AAATAAGTGAAGCCGATAAGGTTATTAAAGCCACTAAAGAAACTAAAGAGACCAAGAAAGAAGCTAAACG
ACTCAAAAAAGAAGCTAGACAGCGCCAACAGATCCCTGATCACAAGAAACCTCAATATGCCTCTGTTGAT
GACACAAAAACTCAAGCGCTTTTTGATATATACGACACCTTGAATGTGAATGACAAAAGTTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAGACAAAACCTATCTCTACGCTATGGATCTATTGGATTACAACAACTA
TTTATCCATAGAAAACCCCATTATCAAAACAAGAGCGATGGGGACTTATGCGGATCTCATCATCATCACA
GGTTCGTTAGAACAAGTCAATGGGTATTACAACATTCTAAAAGCACTCAACAAACGAAACGCTAAGTTTG
TCCTAAAAATCAATGAGAACATGCCTTATGCCCAAGCGACTTTTTTACGAGTGCCAAAAAGAAGCGATCC
TAATGTCCACACGCTTGATAAGGGAGCGTCAATTGATGAGAATAAGCTTTTTGAACAACAAAAACGCGCG
TATTTCAACTACGCCAACGATGTGATCTGCAGACCCAATGATGAAGTGTGTTCGCCCCTAAGAGATGAGA
TGGTCGCTATGCCCACTAGCGATAGCGTTAAACAAAAACCCAATATCATTGCTCCTTATAGCTTGTATAG
ACTAAAAGAGACAAATAACGCCAATGAGGCCCAACCATCACCTTATGCCACTCAAACCGCTCCTGAAAAC
AGCAAAGAGAAGCTCATAGAAGAGCTAATCGCTAACTCCCAACTCATAGCCAATGAAGAAGAGAGGGAAA
AGAAACTCTTAGCAGAAAAAGAAAAACAAGAGGCTGAATTGGCTAAATACAAGCTCAAAGACTTAGAAAA
TCAAAAGAAACTAAAAGCTTTAGAAGCAGAGTTGAAAAAGAAAAACGCTAAAAAACCTAGAGTAGTGGAA
GTTCCTATTTCTCCTCAAACAAGTAATTCTGATGAAACAATGAGAGTTGTCAAAGAAAAAGAGAACTATA
ATGGGTTATTAGTGGATAAAGAGACCACGATCAAAAGAAGCTATGAGGGGACTTTGATCAGTGAAAATTC
TTACAGCAAAAAATCTCCTATCAACCCTAATGACTTGAGGAGCCTAGAAGAAGAAATTAAGAGCTACTAT
ATCAAGTCTAATGGCTTGTGTTACGCTAATGGCATTAGCCTCTATGCAAAAATCAAAAACGACCCCTATA
AGGAGGGAATGCTGTGTGGTTATGAGAGTGTTCAAAATCTGCTCTCACCTTTAAAAGACAAGCTCAAATA
CGACAAGCAAAAGTTACAAAAAGCGTTACTGAAAGATTCAAAGTAA
 Primer design